SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012820 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012820
Domain Number 1 Region: 242-362
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-27
Family Cadherin 0.00092
Further Details:      
 
Domain Number 2 Region: 468-582
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-24
Family Cadherin 0.0035
Further Details:      
 
Domain Number 3 Region: 137-246
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-23
Family Cadherin 0.0022
Further Details:      
 
Domain Number 4 Region: 575-681
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 5 Region: 356-466
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-20
Family Cadherin 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012820
Domain Number - Region: 73-143
Classification Level Classification E-value
Superfamily Cadherin-like 0.000186
Family Cadherin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012820   Gene: ENSTGUG00000012457   Transcript: ENSTGUT00000012966
Sequence length 1159
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:61860389:61945572:1 gene:ENSTGUG00000012457 transcript:ENSTGUT00000012966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLSICCFFFCWAPALSLKNLNYSVPEEQGAGTVIGNIGRDARLAAGAAGGGMLPAERGV
PGGGPGGGRGPKSTFRVLENSAPHLLDVDGESGLLYTKQRIDREALCRRSAKCQLSLEVF
ANDQEICMIKVEIQDLNDNAPSFPSDQVDMDISENAAPGTRFPLTSAHDPDAGDNGLRTY
LLTRDDYGLFSLDVKSRGDGTKFPELVIQKPLDREEQSHHTLVLTALDGGDPPRSGTVQI
NVRLIDSNDNSPIFEAASYVVELPENAPLGTAVIDLNATDADEGTNGEVLYSFSGYAPER
VRDLFSIDPQSGLIRVKGNLDYEESGLIEIDVQARDLGPNPIPAHCKVTVRLIDRNDNAP
TIGFVSVRQGALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGSGGGPGAVPFTLEENY
DNFYTVVTDRPLDREAQDEYNVTIVARDGGNPPLNSTKSFSVRILDENDNPPRFSKFYVL
QVPENNIPGEYGSVLAQDPDLGQNGTVSYSILPGHVGDVSIYTYVSVNPTNGAIYALRSF
NYEQTKHFEFRVLAKDSGSPHRESNATVRVTVLDVNDNAPLIVLPALINDTAELQVPRNA
GVGYPVGTVRALDSDFGESGRLTYEIVEGNEEHLFEMDPTSGEIRTLHPYWEELSPVAEL
VVKVSDHGKPSLSAVAKLIVRALAGPLPEAGEPQVNGEQHRRPHWDLSLPLIVTLSTVSI
ILLAAMITIAVKCKRENKEIRTYNCRIADGSGGGKGKKKKISKNDIMLVPSEGEDSRGPL
NVMNVVSSPSLATSPMYFDYQTRLPLSSPRSEVMYLKPASNNLTVPQGHVGCHTSFTGQG
TNASEAPPSRMSIIQTDNFPAEPNYMGSRQQFVQSSSTFKDPERASLRDSGHGDSDQADS
DQDTNKGSCCDMSVREALKMKTTSTKSQPLEQEQEECVNCTDECRVLGHSDRCWMPQFPA
ASQAENADYRTNLFVPTVEANVETETYETVNPTGKKTFCTFGKDKREHTILIANVKPYLK
AKRALSPLLQEVPSASSSPTKTCIEPCTSTKGPLDGCEVKSGALAEPSSQYLSTDSQYLS
PSKQSKDSSFIASDQMARAFADVHSRVSRDSSEMDSVLEQLDRSARDLGRESVDAEEVVR
EIDKLLQDCRGSDPVAIRK
Download sequence
Identical sequences H0ZQD2
ENSTGUP00000012820 ENSTGUP00000012820 59729.ENSTGUP00000012820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]