SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012848 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012848
Domain Number 1 Region: 574-693
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-28
Family Cadherin 0.0017
Further Details:      
 
Domain Number 2 Region: 477-578
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 149-259
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 682-792
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-18
Family Cadherin 0.0039
Further Details:      
 
Domain Number 5 Region: 260-363
Classification Level Classification E-value
Superfamily Cadherin-like 1.45e-18
Family Cadherin 0.0038
Further Details:      
 
Domain Number 6 Region: 375-482
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000799
Family Cadherin 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012848
Domain Number - Region: 23-99
Classification Level Classification E-value
Superfamily Cadherin-like 0.0565
Family Cadherin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012848   Gene: ENSTGUG00000012481   Transcript: ENSTGUT00000012994
Sequence length 898
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:63359753:63362449:-1 gene:ENSTGUG00000012481 transcript:ENSTGUT00000012994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLLLFLLFVGPFNCFASYSRATELFYSLNEGLPAGVLIGSLARDLRLPTAGGQLAASLLP
PLSFTLASHGLGGQYVHLDNRSGELHTSAVEIDREALCVESSGATIFGGSIAISSSSPSP
ESCLLLLDVLVLPQEYFRLVKVKIAIHDVNDNAPRFPVPHIRLSVPENAPVNTRLAIEHP
ALDPDMGTNGVQTYRLRDNYGVFTLDVEENENGERTPYLIVMGALDRETQDEYVTVIVAE
DGGTPPLVGSATLTIGISDINDNCPQFNDSQLNVTLYGNSSLGTHVATVHAVDMDLGSNA
QITYSYSQKVPQPSRDLFHLNESTGAIILSTKVDGDTPRLHRLIILGNGPGCIPAVITVL
VTIIKVMMRPPEVVPRFIANEVEGVVYLKELEPINTPIAFFTIKDPDEKYKVSCYLDGDG
PFRLSPYKPYNNEYLLETTKPLDFETQQLYEISVVAWNSEGFHVKKVVKVQVLDDNDNSP
VFSEQLIELSIEENNVPNAFLTKLHATDADSGERGQVSYFLGPDAPSYFALDKTTGVLTV
STQLDREEKEKYRYTVKAVDSGFPPRESIATVTITVLDKNDNSPRFINKDFSFFVPENFP
GFGEIGVISVTDADAGQNGWVALSVLNGSDIFVIDTGKGVLRAKVSLDREQQSSYILWIE
AVDGGDPALSSTAKITILLLDINDNPPLVLFPQSNMSYLLVLPSTLPGSPITEVYAVDKD
TGMNAVIAYSIIGRRGPRPESFRIDPKTGNITLEESLMQNDYGLYRLLVKVSDHGYPEPL
HSTVMVNLFVNDTVSNESYIESLLRKEPDISVEEKQPQISIEPTHKKMESASCMPTLVAL
SIISLGSIALVTGMGIYICLRKERKHHRADENLEVQIPLNGRINLHMLEKKPMEISNI
Download sequence
Identical sequences H0ZQG0
ENSTGUP00000012848 ENSTGUP00000012848 59729.ENSTGUP00000012848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]