SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012851 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012851
Domain Number 1 Region: 240-365
Classification Level Classification E-value
Superfamily Cadherin-like 8.38e-31
Family Cadherin 0.00079
Further Details:      
 
Domain Number 2 Region: 560-678
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-30
Family Cadherin 0.002
Further Details:      
 
Domain Number 3 Region: 463-564
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-28
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 136-244
Classification Level Classification E-value
Superfamily Cadherin-like 5e-23
Family Cadherin 0.0035
Further Details:      
 
Domain Number 5 Region: 668-776
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-18
Family Cadherin 0.01
Further Details:      
 
Domain Number 6 Region: 352-461
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-16
Family Cadherin 0.0074
Further Details:      
 
Domain Number 7 Region: 29-122
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000871
Family Cadherin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012851   Gene: ENSTGUG00000012486   Transcript: ENSTGUT00000012998
Sequence length 1032
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:65912194:65915292:-1 gene:ENSTGUG00000012486 transcript:ENSTGUT00000012998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRDFYLLAALIACLKLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSA
SLVYRLVSKAGDAPLVKVSSNTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPN
DFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYE
LLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQV
TVSDVNDNRPVFKESQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK
RFFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDL
RYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL
LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFSQPVIELSVSE
NNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIF
TVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDAD
AGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAK
VTINVMDVNDNSPVVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSG
NNKGLFRIDPVTGNITLEEKPTPNDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGN
ASYIYDLIRRTMETPLDRNIGDSSQPYQNEDYLTIMIAIVAGAMVVIVVIFVTVLVRCRH
ASRFKAAQRSKQGAEWMSPNQENKQNKKKKRKKRKSPKSSLLNFVTIEESKPDDAVHEPI
NGTISLPAELEEQTIGRFDWGTAPPSTFKPNSPDLAKHYKSASPQSAFHLKPDTPVSVKK
HHVIQELPLDNTFVGGCDTLSKRSSTSSDHFSASECSSQGGFKTKGPLHTRQVNEHFYWS
ISTAYKCPINQY
Download sequence
Identical sequences H0ZQG3
ENSTGUP00000012851 59729.ENSTGUP00000012851 ENSTGUP00000012851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]