SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012906 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012906
Domain Number 1 Region: 119-192,243-395
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.72e-28
Family Eukaryotic proteases 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012906   Gene: ENSTGUG00000012537   Transcript: ENSTGUT00000013054
Sequence length 414
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:80024277:80026208:-1 gene:ENSTGUG00000012537 transcript:ENSTGUT00000013054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHMLLLFLIFVPILGLSNGTETEQDFTWHLKKIPQIVRERTFSLDSPKFEAKTKLELNS
VCGIECQRKLPVPSLSDLKSLLSYETVFENGTRTLTEVNVLGAVPDPAANTTTQRPLRKK
RQIYGTDSRFSIYDKRFMTNFPFNTAVKISTGCSGILISPKHVLTAAHCLHNGKDYVKGS
KRLRVGLMKTKSRGNGRKRKGAKRSRREISAAKEDPKATTELRRRSKGDERKQRGSGRKQ
GTSDGMPSFQWTRVKSTHIPKGWFKGVSGDIALDYDYAVLELKRPHKRKYMELGISPTIK
MMPGSMIHFSGFDNDRSGQLLVYRFCSISDESNDLFYQYCDAEPGSTGSGIYLRLKEPNK
KKWKRKIIAVYSGHQWVDINGEQQDYNVAVRITPLKYAQICFWIHGNDENCTQG
Download sequence
Identical sequences H0ZQL6
59729.ENSTGUP00000012906 ENSTGUP00000012906 ENSTGUP00000012906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]