SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012936 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012936
Domain Number 1 Region: 167-352,560-699
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.96e-59
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 2 Region: 3317-3507
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.16e-26
Family APC10-like 0.01
Further Details:      
 
Domain Number 3 Region: 1900-1943,2027-2069
Classification Level Classification E-value
Superfamily E set domains 0.00000000314
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 4 Region: 4056-4118
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000134
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012936
Domain Number - Region: 3285-3346,3624-3706
Classification Level Classification E-value
Superfamily ARM repeat 0.00499
Family Armadillo repeat 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012936   Gene: ENSTGUG00000012556   Transcript: ENSTGUT00000013084
Sequence length 4313
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:70025065:70172746:-1 gene:ENSTGUG00000012556 transcript:ENSTGUT00000013084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRGDCFFLLSLCKDGLYKIGSGYSGTVRGHIYNSTSRIKNRKEKKSWLGYAQGYLLYRDA
NNHSMTAIRINPETLEQDGTVALPDCHTEGQNILFTDGEYINQIAASRDDGFVVRIFATS
TEPVLQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEESAVLGAGREFALMKTASG
KIYYTGKYQSLGIKQGGPSAGKWVELPITKSPKIIQFSVGHDGSHALLVAEDGSIFFTGS
ASKGEDGESTKSRRQSKPYKPKKIIKMEGKIVISTACNNGSSSVISKDGELYMFGKDAIY
SDSTSLVTDLKGHFVTQVAMGKAHTCVLMKNGEVWTFGVNNKGQCGRDTGSMSQGGKGFG
VENMATAMDEDLEEELDEKDEKSMMCPPGMHKWKLEQCMVCTVCGDCTGYGASCVSSGRP
DRVPGGICGCGSGESGCAVCGCCKACARELDGQEARQRGILDAVKEMIPLDLLLAVPVPG
VNIEEHLQLRQEEKRQRVIRRHRLEEGRGPLVIPGPIFMNHREQALARIRLSPAPLKHKR
DKHKDGSGERGEKDASKITTYPPGAVRFDCELRAVQVSCGFHHSVVLMENGDVYTFGYGQ
HGQLGHGDVNSRGCPTLVQALPGPSTQVTAGSNHTAILLMDGQVFTFGSFSKGQLGRPIL
DMPYWNAKPAPMPNIGSKYGRKATWIGASGDQTFLRIDEALINSHVLATSEIFASRHIIG
LVPASISEPPPFKCLLINKVDGSCKTFNDSEQEDLQGSGVCLDPVYDVIWRFRPNARELW
SYNAVVADSRLPSAPDMQSRCSILSPELALPTGSKALTTRSHAALHILGCLDTLAAMQDL
KMGVANTEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADTDILLGGLG
LFGGRGEYTAKIKLFELGPDGGDHETDGDLLAETDVLAYDCAAREKYAMMFDEPVLLQAG
WWYVAWARVSGPSSDCGSHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLYRLPT
SDGSASKGKQQTSEPVHILKRSFARTVSVECFESLLSILHWSWTTLVLGVEELRGLKGFQ
YTATLLDLERLRFVGTCCLRLLRVYTCEIYPISATAKAVVEETSKLADCIGKTRTLLRKI
LSEGVDHCMVKLDNDPQGYLSQPLSLLEAVLQECHNTFTACFHSFYPTPALQWACLCDLL
NCLDQDIQEANFKTSSSRLLAAVMSALCHTSVKLTSIFPIAYDGEALLRSMVKQVSTEND
SALAHRFPLLVAHMEKLSQSEENVSGMTSFREVLEKMLVIVVLPVRNSLRRENELFSSHL
VSNTCGLLASIVSELTASALGSEVDGLNSLHSVKSTPNRFTKTSQGRSWNTGNGSPDAIC
FSVDKPGVVVVGFSVYGGGGIHEYELEVLVDDSDHTGDATHSHRWTSLELVKGTYTTDDS
PSDIAEIRLDKVVPLKENVKYAVRLRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSN
GTNQTRGQIPQILYYRSEYDGDLQSQLLNKANEEDKNCSRALSVVSAVVRAAKDLLHRAL
AVDAEDIPELLSSSSLFSMLLPLIIAYIGPVAAAIPKVAVEVFGLVQQLLPSVAVLNQKY
APPAFNPNQSTDSTTGNQPEQGLSACTTSNHYAVVESEHPYKPASVTHYKVTFPECVRWI
TIEFDTQCGTAQSEDVLRLLIPVRVAQSLGFGPKHTSVHENLNSWIELKKFSGSSGWPTM
VLVLPGNEALFSLETASDYVKDEKACFYGFKCYAIGYEFSPGSDEGIIQLEKELANLGGS
CAAALMKKDLALPIAGIEFEEDLEILEEAALQVCKAHSGILGKGLALSHSPTILEALEGS
LPLQVQSNEQSFLEDFIACVPGSSGGRLARWLQPDSYADPQKTSLILNKDDIRCGWPTVI
TVQTKDQYGEVVHVPNMKVEVKAIPVSQKKTSLQQEQVKKVQRIPGSPATAVSPSSDMTF
GGLPSPKLDSSYEPMIVKEARYIAITMMKAYENYSFEELRFASPTPKRPRPSENMLIRVN
NDGTYCANWTPGAVGLYTIHVTIDGIEIDAGLEVKVKDPPKGMIPPGTQLIKPKAEPQPN
KVRKFVAKDSAGLRIRSHPSLQSEQIGIVKVNGSITFIDEIHNDDGVWLRLNDETIKKYV
PNMNGYTEAWCLSFNQHLGKSLLVPVDESRSNADDFFKDLNSHCPQEAVMQEQDMPFLRG
GPGVYKVVKTGPSGHNIRSCPNLRGIPIGMLVLGNKVKAVGEVTNSEGTWVQMDKNSMVE
FCESDEGEAWSLARDRGGNQYLRHEDEQVLLDQNVQTPPPSPFSIQAFSKGTSCSNGQGF
DYGLGNNKGDRMNFTGAARPISPAGKSDMASKHRADCRSPKLDVRMNRAAAEQKKPRNTD
GLSASECLMLKSDAAKLRSDSHSRSLSPNHNTLQTLKTDGRTTPGLRAESPGPGTRSSSP
KTKTLTGIRSGASSPRSSSPNDKTLPQKAPSPVKTKLDPPRERSKSDSYTLDPDTLRKKK
VPLTEPLRGRSTSPKPKINAKDGKSAPETENRAPSPHVVQENLHSEVVEVCTSSTLKTDS
ITDTTCEDNTEFRSLDDGSNKVHFSIGKAPLKDEQDMRASPKVSRKCAGRHTRPKKEKSN
FLFKGDGSKPIEPAKQAMSPSVAECARAVFAAFLWHEGIVHDAMACSSFLKFNPELSKEH
APIRSSLTQQPAEEKETKLKNRHSLEISSALNMFNISPHGPDISKMGSINKNKVLSMLKE
PPLHEKCEDGKTETTSFETSSHHTMKSKSPLPLTLQHLVAFWEDISLATIKAASQNMIFP
SPGSCAVLKKKESDKDNKKAKKEKKKKEKVEARPRGNLFGEMAQLAVGGPEKDTICELCG
ESHPYPVTYHMRQAHPGCGRYAGGQGYNSIGHFCGGWAGNCGDGGIGGSTWYLVCDRCRE
KYLREKQAAAREKIKQSRRKPMQVKTPRALPTMEAHQVIKANALYLLSLSSAAEPSILCY
NPAKAFQSQLPSLKEGISEDFPIKMPCLYLQTLARHHHENFVGYQDDNLFQDEMRYLRST
SVPAPYISVTPDASPNVFEEPESNMKSMPPSLETSPITDTDLAKRTVFQRSYSVVASEYD
KQHSILPARVKAIPRRRVNSGDAEVGSSLLRHPSPELSRLISAHSSLSKGERNFQWPVLA
FVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAP
VEPEEEEDEENKSNKENAEQEKDTRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMM
SLPSGSALQQMALRCWSLKFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISVQSG
FEVMNQELCIVVCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITIN
CVKGINARYVCVHVDNSRDLGNKVTSMTFLTGKAVEDLCRIKQVDLDSRHIGWVTSELPG
GDNHIIKIELKGPENTLRVRQVKILGWKDGESIKIAGQISASVAQQRNCESETLRVFRLI
TSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKVHNATSDADLKEHMVGIIFSRSKLTNL
QKQVCAHIVQAIRMEATRVREEWEHAISSKENANSQPSDEDASSDAYCFELLSMVLALSG
SNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPSRLASIIGVKSLPP
ADISDIIHSTEKGDWNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTAAGKGVTTVTL
PMIFNSSYIRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKNAIAETIIA
LTKMEEEYRSPVRCIATTRLWLALASLCVLDQDHVDRLSSGRWMGKDGQQKQMPMCDNHD
DGETAAIILCNVCGNLCTDCDRFLHLHRRTKTHQRQVFKEEEEAIKVDLHEGCGRTKLFW
LMALADSKTMKAMVEFREQTGKPTTSSSEACRFCGCRSGTELSAVGSVCSDTDCQEYAKI
ACSKTHPCGHPCGGVKNEEHCLPCLHGCDKNATTLKQDADDMCMICFTEALSAAPAIQLD
CSHVFHLQCCQRVLENRWLGPRITFGFMSCPICKNKINHTVLKDLLDPIKELYEDVRRKA
LMRLEYEGLHKSEAITTPGVRFYNDPAGYAMNRYAYYVCYKCKKAYFGGEARCDAEAGQG
DDYDPRELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQ
RMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF
Download sequence
Identical sequences H0ZQP6
ENSTGUP00000012936 ENSTGUP00000012936 59729.ENSTGUP00000012936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]