SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013027 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013027
Domain Number 1 Region: 126-317
Classification Level Classification E-value
Superfamily vWA-like 9.49e-60
Family Integrin A (or I) domain 0.000087
Further Details:      
 
Domain Number 2 Region: 1174-1376
Classification Level Classification E-value
Superfamily vWA-like 1.22e-58
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 2291-2504
Classification Level Classification E-value
Superfamily vWA-like 1.16e-56
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 4 Region: 429-616
Classification Level Classification E-value
Superfamily vWA-like 5.72e-56
Family Integrin A (or I) domain 0.00014
Further Details:      
 
Domain Number 5 Region: 2521-2724
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.69e-32
Family Laminin G-like module 0.089
Further Details:      
 
Domain Number 6 Region: 905-1073
Classification Level Classification E-value
Superfamily Fibronectin type III 2.16e-22
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 7 Region: 1938-2024
Classification Level Classification E-value
Superfamily Fibronectin type III 9.01e-22
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 8 Region: 723-892
Classification Level Classification E-value
Superfamily Fibronectin type III 1.57e-21
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 9 Region: 2028-2197
Classification Level Classification E-value
Superfamily Fibronectin type III 2.95e-21
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 10 Region: 334-427,622-712
Classification Level Classification E-value
Superfamily Fibronectin type III 5.86e-21
Family Fibronectin type III 0.00095
Further Details:      
 
Domain Number 11 Region: 1756-1843
Classification Level Classification E-value
Superfamily Fibronectin type III 9.22e-21
Family Fibronectin type III 0.00089
Further Details:      
 
Domain Number 12 Region: 1383-1470
Classification Level Classification E-value
Superfamily Fibronectin type III 3.11e-20
Family Fibronectin type III 0.00053
Further Details:      
 
Domain Number 13 Region: 1568-1727
Classification Level Classification E-value
Superfamily Fibronectin type III 4.16e-19
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 14 Region: 1086-1173
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-17
Family Fibronectin type III 0.00068
Further Details:      
 
Domain Number 15 Region: 1474-1562
Classification Level Classification E-value
Superfamily Fibronectin type III 3.02e-16
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 16 Region: 26-108
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-16
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 17 Region: 1846-1933
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000106
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 18 Region: 2209-2292
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000162
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013027   Gene: ENSTGUG00000012648   Transcript: ENSTGUT00000013176
Sequence length 2885
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:83174975:83259953:1 gene:ENSTGUG00000012648 transcript:ENSTGUT00000013176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTALCSAVAALCAATLLSSIEAEVNPPSDLNFTIIDEHNVQMSWKRPPDAIVGYRITVV
PTNDGPTKEFTLSPSTTQTVISDLIPDVEYIVSIASYDDREESLPVFGQLTIQTGGPGIP
EEKKVEAQLQRCSISAMTDLVFLVDGSWSVGRNNFGYILDFMVALVSAFDIGEEKTRVGV
VQYSSDTRTEFNLNQYFRRSDLIDAIKRIPYKGGNTMTGEAIDYLVQNTFTESAGARKGF
PKVAIVITDGKAQDDVEIPARELRNIGVEVFSLGIKAADAKELKLIASQPSLKHVFNVAN
FDGIVDIQNEIILQVCSGVDEQLGELVSGEEVVEPPSNLVATQISSKSVRITWDPSTSQI
TGYRLQFIPMIAGGKQHVLSVGPQTTALNVKDLSPDTEYQINVYAMKGLTPSEPITIMEK
TQQVKVQVECSRGVDVKADVVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPRKVQISL
VQYSRDPHMEFSLNRYNRVEDIIQAINTFPYRGGSTNTGKAMTYVREKVFVTSKGSRPNV
PRVMILITDGKSSDAFKEPAIKLRDADVEIFAVGVKDAVRTELEAIASPPADTHVYTVED
FDAFQRISFELTQSVCLRIEQELAAIRRKSYVPAKNMVFSDITSESFKVSWSPAGSEVLS
YLIKYKVAVGGDEFIVSVPASSTSSVLTNLLPETTYAVSVISEYEDGDGPPLDGEETTLE
VKGAPRNLRITDETTDSFVVGWTPAPGNVLRYRLVYGPLTGGERRQVTVSANDRSTTLQN
LNQDTRYEVSVVPEYQSGPGNSLNGYAKTDEVRGNPRNLRVSDATTSTMKLSWGAAPGKV
QQYFITYTPVAGGETKEVTVKGDTTSKVLKGLDQATRYALTVSALYASGAGDALSGEGET
LEERGSPRNLVTTDITDTTVGLSWTPAPGTVNHYRIVWKSHYDDTMGEKRVPGNTVDAVI
EGLEPETKYRISVYAAYSSGEGDPVEGEAFTDVSPNARSLTVDSETENTMRVKWQPSPGK
VLSYRVNYRARSGGRQMSGRVNAPATSIVLKRLKPRTTYDLTVVPIYDFGHGKSRKGEGT
TASPFKPPRNLRTSDSTMSSFRVTWEPAPGRVKGYKVTFHPTEDDGSLGELIVGPYDSTV
VLEELRAGTTYKVNVFGMFEGGESNPLVGQEMTTLSDTTTEPFLSRGLECRTRAEADIVL
LVDGSWSIGRPNFKTIRNFIARIVEVFDIGPDRVQIGLAQYSGDPRTEWNLNAYRTKQSL
LEAVANLPYKGGNTLTGMALDFILRNNFKPVAGLRPRARKIGVLITDGKSQDDVVAPSRK
LRDEGVELYAIGIKNADENELKQIATDPDDIHAYNVADFSFLATIVDNVTTNLCNSVKGP
GDLPPPSNLVISEVTPRSFRLRWSPPPESVDRYRVEYYPTSGGSPKQFYVSRMERTTVLK
DLQPETEYVVNVFSVVEDESSEPLIGRETTLPISSVRNLNVYDIGSTYMRVRWEPLNGAT
GYLLTYEPVNATVPATEKEMHVGPSVNEVQLVDLIPNTEYTLTAYVLFGDMKSDPLTTQE
VTLPLPGPRGLTIQDVTHSTMNVLWDPAPGKVRKYILRYKITDDADVKEVELDRLKTSIT
LSDLSSQKLYNVEVVAVYDEGESIPTNAEAVTQPVPAPVNLRITDITTNSFRGTWDHGAP
DVSLYRITWGPYGKAEKQETILNGEENSLVFENLNPDTLYDVSVTAIYPDESESDELIGS
ERTLPLVPITTQAPKSGPRNLQVYNATSHSLTVKWDPASGRVQRYRIIYQPISGDGPEQS
TTVGGRQNSVVIQKLQPDTPYAITVSSMYADGEGGRMTGRGRTKPLTTVKNLMVYDPTTS
TLNIRWDHAEGSPRQYKVFYGPTAGGAEEMTTVPGNTNYVILRTLEPNTPYTVTVVPVFP
EGDGGRTSDTGRTLERGTPRNIHVYNPTPNSMNVRWEPAPGPVQQYRINYAPLSGPRPSE
SIVVPGNTRDVILERLTPDTAYSISVIALYADGEGNPSQAQGRTLPRSGPRNVRVFDETT
NSLSVQWDHADGPVQQYRIIYSPTVGDPIDEYTTVPGIRNNVILQPLQSDTPYKITVVAV
YEDGDGGQLTGNGRTVGLLPPQNMYITDEWYTRFRVSWDPSPSPVLGYKIVYKPVGSNEP
REFFVGEVTSYTLHNLSPSTTYDVNVYAQYDSGMSIPLTDQGTTLYLNVTDLTSYKVGWD
TLCIRWSPHRSATSYRLKLNPTDGSRGQEITIRGSETSHCFTGLSPDTEYNATVFVQTPN
LEGPPVSMRAHTVLKPTEAPTPPPTPPPPPTIPPARDVCRGAKADIVFLTDASWSIGDDN
FNKVVKFVFSTVGAFDLINPAGIQVSFVQYSDEAKSEFKLNTFDDKAQALGALQNIQYRG
GNTRTGKALTFIKEKVLTWESGMRRGVPKVLVVVTDGRSQDEVRKAATVIQHSGFSVFVV
GVADVDYNELAKIASKPSERHVFIVDDFDAFEKIQDNLVTFVCETATSTCPLIYLEGYTS
PGFKMLESYNLTEKHFASVQGVSLESGSFPSYVAYRLHKNAFVSQPIREIHPEGLPQAYT
IILLFRLLPESPNEPFAIWQITDRDYKPQVGVVLDPASKVLSFFNKDARGEVQTVTFDND
DVKKIFYGSFHKVHIVVTSSNVKIYIDCSEIMEKPIKEAGNITTDGYEILGKLLKGDRKS
ATLEIQNFDIVCSPVWTSRDRCCDLPSMRDEAKCPALPNACTCTQDSVGPPGPPGPAGGP
GAKGPRGERGLTGSSGPPGPRGETGPPGPQGPPGPQGPNGLSIPGEPGRQGMKGDAGQPG
LPGRSGTPGLPGPPGPVGPPGERGFTGKDGPTGPRGPPGPAGAPGVPGVAGPSGKPGKPG
DRGTP
Download sequence
Identical sequences H0ZQY6
59729.ENSTGUP00000013027 ENSTGUP00000013027 ENSTGUP00000013027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]