SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013098 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013098
Domain Number 1 Region: 361-417
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000523
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 2 Region: 423-471
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000101
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 3 Region: 475-530
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000116
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 4 Region: 309-358
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000222
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 219-271
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000392
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013098
Domain Number - Region: 898-1077
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000412
Family Rhodopsin-like 0.034
Further Details:      
 
Domain Number - Region: 547-594
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00235
Family Hormone receptor domain 0.0071
Further Details:      
 
Domain Number - Region: 9-70
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0179
Family Spermadhesin, CUB domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013098   Gene: ENSTGUG00000012707   Transcript: ENSTGUT00000013247
Sequence length 1528
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:154655775:154881677:1 gene:ENSTGUG00000012707 transcript:ENSTGUT00000013247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTTLVQGKFFGYFSSFAVFPLNSSLCSWIIQNPDPRRYTLYMKILKPSGVCDHQHIRTYQ
FDSFLESTRTYLGMESFDDVLKLCDGSTRFAFLQSNKQFLQMKQTAPPGVDTWPMRWKPT
KAQERDFSVEYLVVGNRNPSKAACQMLCKWLDACLAISSSSHPCGIMQTPCSCSGGEVLD
QASEILGFTRKKEDCYKDGIYLENCVSSPKDTNGADGHSCGWNSWSAWGDCTKDCGGGLQ
TRMRSCKPLPNEGLACEGVLEEGRLCNRKACNTNGRYNSRSQSLRSTDNRKREDPDELQH
YGYPAPQIGDPAAEEWSPWSVCSTTCGEGWQTRTRFCVSSSYSTQCSGPLREQRQCNNSA
VCPVHGTWDEWSPWSLCSSTCGRGYRDRTRTCKPPQFGGNPCEGPEKQTKFCNIALCPGR
DMDGNWNEWSSWSSCSASCSNGTQQRTRECNGPSYGGAECQGHWVETRDCFLRQCPVDGK
WQAWGVWGSCTATCGGGTQRRDRVCYGPFFGGETCQGPKEEYKQCNDRKCPEPHEICDEE
SLGPVVWKETPAGDAAAVRCPRNATGLILRRCILDEEGIAYWEPPTYIKCVSIDYRNIQM
MTREHLAKAQRGLMVDGLSDVLQNLVEISQDGTSYSGDLLSTMDVLRNMTEIFRRAYHSP
TSGDVQNFVQIISNILSEENREKWEEAQLIGPNAKELFRLVEDFIDVIGFRMKDFRDSYQ
VTDNLVLGIHKLPANAATDITFPMKGWRGMVDWAKNSEDKVTVSKSILSSGLSVSDDSSV
FVVGTVLYRNVGNILSLQRNSTVLNSKVISVTVKPFPRSLLTPLEIEFSHLYNGTTNQTC
ILWDENDGASASASPPGAWSWRGCRTVPLDASRTKCLCDRLSAFAILAQLSPDMNMEKVL
VPSVTLIVGCGVSSLTLLLLIIIYVSVWRYIRSERSVILINFCLSIISSNALILIGQTQT
RNKVICTLVAAFLHFFFLSSFCWVLTEAWQSYMAVTGRLRNRIIRKRFLCLGWGLPALVV
AISVGFTKAKGYGTVNYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITD
KKLKERAGASLWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSLEGFVIVMVHC
ILRREVQDAVKCRVVDRQEEGNGDSGGSFQNGHAQLMTDFEKDVDMACRSVLNKDITTCR
TSTITGTLKRPSLPDEEKLKLNHQKGSSNFNSLPANVSKMHLQGSPHYLGAINLNEFSNH
SLTLKKDKNQPPKSIYICDGDIFKKLDSELSRAQEQTLDTSYVILPTNTSTLRAKPKDES
KYSINIDQMPQTRLIHLSMATDPGFVVKSPPREPVTMACSEVQGSSMIQQQQQLAPQNIS
NESQIPNSLCDTGDSGNSGVVSKSETVSTLSMSSLERRKSRYAELDFEKIMHTRKRHQDM
FQDLNRKLQHAEKEKESPTTDSKQEKQQTPNKRPWEGIRKVQSPPSWVKKDIEPVAQSPL
ELKTVEWEKTGATIPLVGQDIIDLQTEV
Download sequence
Identical sequences H0ZR56
ENSTGUP00000013098 ENSTGUP00000013098 59729.ENSTGUP00000013098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]