SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013110 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000013110
Domain Number - Region: 33-176
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0442
Family Protein kinases, catalytic subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013110   Gene: ENSTGUG00000012736   Transcript: ENSTGUT00000013259
Sequence length 281
Comment pep:novel chromosome:taeGut3.2.4:5:49419322:49426151:1 gene:ENSTGUG00000012736 transcript:ENSTGUT00000013259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYGQCYDNSGDAELRVTAMLELGSPLEMIQLLQTPWEERFKICLSLVKLLFYLAHSPLGS
IALLDFQPRQFVMVDGNLKVTDMDDASTEELSCKEDNDCTLDFPTKSFPLKCSVVGKCEG
INEKKNLFNAYRYFFTYLLPHSAPPALRPLLSDILNATGDLRYGINETLRAFEKVLHLYK
SGLYLQKRPLLLKGNYISLKGFRTVEGEGHKCWPSYSHLGCLLSIHSAEEAAAICNSQLH
CQSFIVTQHRTWTGRPLASFQSSWTDLIPDTNAVVYIKRSA
Download sequence
Identical sequences H0ZR68
ENSTGUP00000013110 59729.ENSTGUP00000013110 ENSTGUP00000013110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]