SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013132 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013132
Domain Number 1 Region: 341-396
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000103
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 2 Region: 396-451
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000262
Family TSP-1 type 1 repeat 0.00049
Further Details:      
 
Domain Number 3 Region: 293-336
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000327
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 4 Region: 451-506
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000128
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013132
Domain Number - Region: 43-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00852
Family Spermadhesin, CUB domain 0.0097
Further Details:      
 
Domain Number - Region: 879-1065,1094-1175
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0192
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013132   Gene: ENSTGUG00000012749   Transcript: ENSTGUT00000013281
Sequence length 1521
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:85630461:86076108:-1 gene:ENSTGUG00000012749 transcript:ENSTGUT00000013281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVRNLLIYIFSTYLLVMFGFNAAQDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLE
NPDPTKYSIYLKFSKKDFSCSNFSLLAYQFDHFSHEKIKDLLKNNHSIMQLCNSKNAFVF
LQYDKNFIQIRRVYPINFPGLHKKEEDQKSFFEFLVLNKVSPSQFGCHVLCTWLESCLKS
ENGRTESCGIMYTKCTCPQHLGEWGIDDQSLVLLNNVVLPLNEQTEGCLTQELQTTQVCN
LTREAKRPPKEEFGMMGDHTIKSQRPRSVHEKRVPQEQADAAKFMAQTGESGVEEWAQWS
TCSVTCGQGSQVRTRTCVSPYGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFTC
GRGQRTRTRSCIPPQYGGRSCDGPETQHKPCNIALCPVDGQWQEWSSWSQCSVTCSNGTQ
QRSRQCTAAAHGGSECRGPWAESRECHNPECTANGQWNQWGHWSGCSKSCDGGWERRIRI
CQGAAVTGQQCEGAGEEVRRCSEQRCPAPYEICPEDYLMSMVWKRTPAGDMAFNRCPLNA
TGTTSRRCSLSVHGVAFWEHPSFARCISNEYRHLQHSIKEHLAKGQRMLAGDGMSQVTKT
LLDLTQRKNFYAGDLLISVEILRNVTDTFKRASYIPASDGVQNFFQIISNLLDEENKEKW
EDAQQIYPGSVELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINFP
MKGRKGMVDWARNSEDRVVIPKNIFTPMSTAELDESTVFVLGAVLYKNLELILPTLRNFT
VVNSKIIVVTIRPEPKTTDSFLEIELAHLSNGTLNPYCVLWDDSRMNDSLGTWSTQGCKT
VLTDASHTKCLCDRLSTFAILAQQPREIIMESSGTPSVTLIVGSGLSCLALITLAVVYAA
LWRYIRSERSIILINFCLSIISSNILILVGQTQTHNKGICTTTTAFLHFFFLASFCWVLT
EAWQSYMAVTGKIRTRLIRKRFLCLGWGLPALVVAISIGFTKTKGYGTAHYCWLSLEGGL
LYAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRAGQMSEPHSGLTLKCAKCGV
VSTTALSATTASNAMASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQGF
VIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFPNGHAQIMTDFEKDVDIACRSVLH
KDIGPCRAATITGTLSRISLNDEEEEKGPNPEGMSYSTLPGNIISKVIIQQPTGLHMPMS
MSELANQCLKKDNSELRRTVYLCTDDNLRGADMDIVHPQERMIESDYIVMPRGSVNTQPS
LKDESKMNIGMDTLPHERLLHYKVNPEFNMNPSVMDQFNINLDQHLPTQEHMQSLPFEPR
TAVKNFIASELDDNAGLSRSETGSTISMSSLERRKSRYSDLDFEKVMHTRKRHMELFQEL
NQKFQTLDRFRDVPKSGSMENSGPSKAPWESFKTTGDYQHYTTINVLDTEAKDALELRPA
EWEKCLNLPLDVQEGDFQTEV
Download sequence
Identical sequences H0ZR89
ENSTGUP00000013132 ENSTGUP00000013132 59729.ENSTGUP00000013132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]