SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013145 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013145
Domain Number 1 Region: 140-327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.68e-27
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 2 Region: 81-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000011
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 5-82
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000461
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 4 Region: 404-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000368
Family Laminin-type module 0.056
Further Details:      
 
Domain Number 5 Region: 357-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000201
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013145   Gene: ENSTGUG00000012767   Transcript: ENSTGUT00000013294
Sequence length 436
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:87850683:87938554:1 gene:ENSTGUG00000012767 transcript:ENSTGUT00000013294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEVAADGNPPVQHRLSVSHHTSQINFGSIFLGKVPVHEEVNRCAGKIYGYKGCIRDFQVN
HKELFIIDEALEGRNVENCNVPICGYHPCHNGGTCISDEENWYCECPKLYTGKLCQFATC
DENPCGNGATCFPKSRRDAVCLCPYGRSGILCSDAINITQPSFGGTDVFGYTSFLAYSTI
PNITFYYEFRLKFWLANHHSALQDNLIFFTGQKGQGLNGDDFLELGLRNGRVVYSYNLGS
GTATIISKPLDLTLNVHIIHLGRNLQKGWLKVDDQKNKTVTSPGRLVGLNVFSQFYLGGY
REYTPELLPKGPRFKNGFQGCIFDVQVRTSLDQGFKAPGTPEGHPNSGRSVGQCKDSPCS
LIKCRNGGKCIESGSTVYCDCLTGWKGAFCTETVSVCEPEHDPPHLCQQGSTCVPLPNGY
TCHCPLGTTGTYCEQG
Download sequence
Identical sequences H0ZRA2
ENSTGUP00000013145 59729.ENSTGUP00000013145 ENSTGUP00000013145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]