SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013191 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000013191
Domain Number - Region: 6-111
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0942
Family Growth factor receptor domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013191   Gene: ENSTGUG00000012811   Transcript: ENSTGUT00000013340
Sequence length 337
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:79491405:79502376:1 gene:ENSTGUG00000012811 transcript:ENSTGUT00000013340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPALYACTKCNQRYPFEELSQGQQLCKECRIAHPIVKCTYCRSEFQQESKTNTICKKCA
QNVKQFGTPKPCQYCNIIAAFIGTKCQRCTNSEKKYGPPQTCEQCKQQCAFDRKEEGRRK
VDGKLLCWLCTLSYKRVLQKTKEQRKSLGSSHSNSSSSSLTEKDQHHSKHHHHHHHHHRH
SSSHHKISNLSPEQDQGLWKQSHKSSAAIQNETPKKKPKLESKPSNGDSSSINQSADSGG
TDNFVLISQLKEEVMSLKRLLQQRDQTILEKDKKLTELKADFQYQESNLRTKMNSMEKAH
KETVEQLQAKNRELLKQVAALSKGKKFDKSGNILTSP
Download sequence
Identical sequences H0ZRE8
ENSTGUP00000013191 ENSTGUP00000013191 59729.ENSTGUP00000013191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]