SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013193 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000013193
Domain Number - Region: 71-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000358
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013193   Gene: ENSTGUG00000012812   Transcript: ENSTGUT00000013342
Sequence length 226
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:50913504:50918529:1 gene:ENSTGUG00000012812 transcript:ENSTGUT00000013342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKLKKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLADGHQSDSDDYSELSIEDDEEGKVK
GKDALFSSSNYNLKPKTFKCQTCEKSYIGKGGLARHYKLNPDHGQLEPSPQKIPLNKPNG
TTSLEETIDSKGGEQVKSDSNTSSALSFSLAEIIFVYTRLIQQCDNEDLMELALPRLTKL
VTVYEFLVMKVEKGHPAKAYFPDVYREFEDLHNMVKKMAYDHLSNS
Download sequence
Identical sequences H0ZRF0
ENSTGUP00000013193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]