SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013208 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013208
Domain Number 1 Region: 31-217
Classification Level Classification E-value
Superfamily vWA-like 9.05e-55
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 2 Region: 229-417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.05e-29
Family Laminin G-like module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013208   Gene: ENSTGUG00000012827   Transcript: ENSTGUT00000013358
Sequence length 955
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:89563855:89625010:1 gene:ENSTGUG00000012827 transcript:ENSTGUT00000013358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQIVIFFQMLLVLLLHDYISAEDGETRASCRTAPADLVFILDGSYSVGPENFEIIKSWL
VNITRNFDIGPKFIQVGVVQYSDYPVLEIPLGTHESTENLIREMESIHYLGGNTRTGRAI
QFAFDHLFAKSSRFLTKIAVVLTDGKSQDEVKDVAAEARKNKITLFAIGVGSEIEEDELK
AIANKPSSTYVFYVEDYIAISRIKEVIKQKLCEESVCPTRIPVAARDEKGFDILVGLGVK
KKVKKRIQISSTNAKAYEVTSRVDLSELTRNVFPEGLPPSYVFVSTQRFKVKKTWDLWRI
LSLDKRPQIAVTVNGEEKTLLFTTTSLINGTQVITFATPHVKTLFDEGWHQIRLLVAEDF
VTLYIDGQEIETKPLHPVLGIYISGLTQIGKYSGKEETVQFDIQKLRIYCDPEQNNRETV
CEIPGFVTECMNGPSDVGSTPAPCMCPPGKQGPPGPKGDPGQPGNHGYPGLPGPDGKPGY
QGSAGTPGIPGTPGIQGPRGLPGIKGEPGKDGAKGDSGLPGFPGLHGMPAPKGERGPKGD
QGVPGIYGKKGSKGEKGDTGFPGLPGRSGDPGRNGKDGLPGSPGFKGEVGQPGSPGLEGH
RGEPGIPGIPGNQGTKGQKGEIGPPGQPGAKGSPGDTGLMGPEGSLGLPGAPGPKGDKGE
PGLQGKPGSSGAKGDLGIPGAPGEPGYPGIPGTQGLKVSNFFQIKSLGLKGEKGRQGNPG
LQVLSLHQVKYIYKGEKGDPGIRGISGQKGESGVQGLTGPPGLRGQQGDRGPPGPPGSDG
KPAREFSEEFIRQVCSDVLRTQLPAILQSGRLQNCNQCQPQNAPPGLPGPPGPRGPEGPR
GFPGLPGNDGIPGLMGLPGRPGARGTRGLPGKNGAKGNQGVGVPGIQGPPGPPGPEGPPG
MSKEGRPGERGQPGKDGDRGTPGMPGPVGPPGICDPSLCFSVIVGRDPFRKGPNY
Download sequence
Identical sequences H0ZRG5
ENSTGUP00000013208 59729.ENSTGUP00000013208 ENSTGUP00000013208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]