SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013241 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013241
Domain Number 1 Region: 53-308
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-98
Family Protein kinases, catalytic subunit 0.00000975
Further Details:      
 
Domain Number 2 Region: 690-799
Classification Level Classification E-value
Superfamily KA1-like 1.55e-47
Family Kinase associated domain 1, KA1 0.00000349
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013241
Domain Number - Region: 327-365
Classification Level Classification E-value
Superfamily UBA-like 0.0211
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013241   Gene: ENSTGUG00000012848   Transcript: ENSTGUT00000013391
Sequence length 799
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:51699854:51759229:1 gene:ENSTGUG00000012848 transcript:ENSTGUT00000013391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRTPLPTVNERDTENHTSHGDGRQEVSSRTGRSGARCRNSIASCADEQPHIGNYRLLK
TIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFE
VIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLK
AENLLLDADMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLG
VILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPTKRGTLEQ
IMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITAT
YLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSISSSQKQRRYSD
HAGPSIPSVVAYPKRSQTSTTDSDLKEEGIQSRKSSSSAVAGRGIAPASPMLGNASNPNK
ADIPERKKSSAVPSNNTTPGAMTRRNTYVCSERTTADRHSVIQNGKENSLTEMFAYAASP
ASVCTTSFSSVRLRHQKSMSMSASVHTKMMLPPIDNGADNFRPITIPDQRTPVASTHSIS
SATTPDRIRFPRGTASRSTFHGQLRERRTATYNGPPASPSLSHEATPLSQTRARGSTNLF
SKLTSKLTRRLPTEYERNGRFEGSSRNVAVDQKDENKEAKPRSLRFTWSMKTTSSMDPND
MMREIRKVLDANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRIS
GTSIAFKNIASKIANELKL
Download sequence
Identical sequences H0ZRJ7
ENSTGUP00000013241 XP_002200615.3.42559 59729.ENSTGUP00000013241 ENSTGUP00000013241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]