SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013261 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013261
Domain Number 1 Region: 80-220
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.56e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.0000033
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.42e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013261   Gene: ENSTGUG00000012878   Transcript: ENSTGUT00000013411
Sequence length 222
Comment pep:novel chromosome:taeGut3.2.4:3:90740481:90746412:1 gene:ENSTGUG00000012878 transcript:ENSTGUT00000013411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKPRLTYLNGRGRMESIRWLLAAAGVEFEEVYLETKEQYDKLIKDGFLLFQQVPLVEI
DGMKMVQTRAIMSYIAGKYNLYGKDLKERALIDMYVEGISDLMQMILVFPFSPPDAKEKN
LESIKERATNRYFPVFEKVLKQHGQDFLVGNKFSWADVQLIEAILAVEEKVPDVLSGFPQ
LQVFKTKMSNIPTIKKFLQPGSPRKPPPDAHYVETVLKVFKK
Download sequence
Identical sequences H0ZRL7
XP_002193687.1.42559 ENSTGUP00000013261 59729.ENSTGUP00000013261 ENSTGUP00000013261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]