SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013263 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013263
Domain Number 1 Region: 80-208
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.81e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.87e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013263   Gene: ENSTGUG00000012881   Transcript: ENSTGUT00000013413
Sequence length 221
Comment pep:novel chromosome:taeGut3.2.4:3:90752731:90758202:1 gene:ENSTGUG00000012881 transcript:ENSTGUT00000013413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKPKLHYINGRGRMEPIRWLLAAAGVEFEESYLEKKEDLTKLQKDGSLLFQQVPMVEI
DGMKLVQTRAIANYIATKYNLYGKDVKERALIDMYVEGMFDLNELLLKNRYLPADQKEQH
FANMMDKATNRYFPVFEKVLKDHGKDFLVGNQLSRADVQLLEIILMAEEYQPDVLAKFPL
LQSFKARISNIPTIKKFLQPGSQRKPVIREEEVPKVIKIFH
Download sequence
Identical sequences H0ZRL9
ENSTGUP00000013263 ENSTGUP00000013263 59729.ENSTGUP00000013263 XP_002195892.1.42559 XP_012428278.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]