SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013265 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013265
Domain Number 1 Region: 887-1010
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-25
Family Ankyrin repeat 0.000000638
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.12e-24
Family Ras-binding domain, RBD 0.0074
Further Details:      
 
Domain Number 3 Region: 839-857,1017-1077
Classification Level Classification E-value
Superfamily SH3-domain 1.27e-19
Family SH3-domain 0.0000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013265   Gene: ENSTGUG00000012883   Transcript: ENSTGUT00000013415
Sequence length 1086
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:51984072:52053225:-1 gene:ENSTGUG00000012883 transcript:ENSTGUT00000013415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDH
MMYDHLQKWGPRREEVKFFLRHEESPAESNEQSGRPAQNQRNGINIPVEKRAENGVGNPR
VELTLSELQDMAARQQQQIENQQQMLVAKEQRLRYLKQQERRQQQSVSESEKLQKLKERV
ETQETKLKKIRAMRGQVDYSKMMNGNLSTEIEHISAMFQEKQQELQAAVLKVDQLTQQLE
DLRKGKLNGFQSYNGQMTGPAAVELKKLYQELQIRNRLNQEQNSKLQQQKELLNKRNMEV
AMMDKRINELRERLYKKKMELNRINGTSSPQSSLSASGRVAAVGPYIQVPSAGTYAVPVD
PVKPQSLTIAPNSTHGRSKSANDGNWPILKQSSAPVVKPPQISNTDWKESSMDTALKQGT
ISSQPLPTSVLGSTDKLGLDLGKVPPTVPGVSKQLPQNYGTYPSPVPLGTGSTNSLERRK
DGSLPRPGTSIANRQRPVPLPPPSNVHQPSSSQQIQQRISVPPSPTYQPSGPPLFPGGEG
RPELPLTVAIRPFLADKGSRPQSPRKGPQTVNSSSIYSVYLQQATPPKNYQQAVYNTLNK
SVKAVYGKPVLQSGSTSPSPLPFLHGSLPAQSPSQPQSQSQTEVIEKDQELENAPPPSEN
SNVENIPRPLSPTKLTPIVHSPLRYQSDADLEALRRKLANAPRPLKKRSSITEPEGPSGP
NIQKLLYQRFNTLAGGIESAPFYQPSNPQDFIGNLADVDNGNASTNGNIEEPIPMQPTVP
VPDEPPPSSDANDNELPSPATEELISPETTNQTPETTEDNNNNLSIVPSTEQSPSPTPEV
SSPVEDEPPLPPALPPPLPPTKRTNLKKPNSERTGHGLRVKFNPLALLLDASLEGEFDLV
QRIIYEVDDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAADSDGWTPLHCAASC
NSVHLCKLLVESGAAIFASTISDIETAADKCEEMEEGYIQCSQFLYGVQEKLGVMNKGVV
YALWDYEAQNNDELSFHEGDAITILRRKDDNETEWWWARLNDKEGYVPKNLLGLYPRIKP
RQRTLA
Download sequence
Identical sequences H0ZRM1
ENSTGUP00000013265 59729.ENSTGUP00000013265 ENSTGUP00000013265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]