SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013268 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013268
Domain Number 1 Region: 81-212
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.56e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.00000482
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.44e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013268   Gene: ENSTGUG00000012882   Transcript: ENSTGUT00000013418
Sequence length 222
Comment pep:known chromosome:taeGut3.2.4:3:90760574:90769559:1 gene:ENSTGUG00000012882 transcript:ENSTGUT00000013418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKPKLHYTKGRGKMESIRWLLAAAGVEFEEEFIETKEDLEKLRNDGVLLFQQVPMVEM
DGMKMVQTRAILSYIAAKYNLYGKDLKERAWIDMYVEGTTDLMGMIMYLPFQPADTKEKN
LALIIERATTRYFPVYEKALKDHGQDYLVGNKLSWADVHLLEAILMVEECKPDVLSAFPL
LQAFKGRISNIPTIKKFLQPGSQRKPPIDEKFVAVVRKIFNI
Download sequence
Identical sequences B5FYW2
59729.ENSTGUP00000013268 ENSTGUP00000013268 ENSTGUP00000013268 NP_001232758.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]