SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013278 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013278
Domain Number 1 Region: 69-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-33
Family Spermadhesin, CUB domain 0.00091
Further Details:      
 
Domain Number 2 Region: 5-66
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000134
Family Complement control module/SCR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013278   Gene: ENSTGUG00000012895   Transcript: ENSTGUT00000013428
Sequence length 172
Comment pep:novel chromosome:taeGut3.2.4:3:92052587:92179019:1 gene:ENSTGUG00000012895 transcript:ENSTGUT00000013428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSHTCGNPGEIPKGVLHGTRFNIGDKIRYSCISGYILEGHAMLTCIVSPGNGASWDFPV
PFCRAEGACGGTLRGTSGIISSPHFPSEYENNADCTWTILAEPGDTIALVFTDFQLEEGY
DFLEISGTEAPSIWLSGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQG
Download sequence
Identical sequences H0ZRN4
ENSTGUP00000013278 59729.ENSTGUP00000013278 ENSTGUP00000013278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]