SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013292 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013292
Domain Number 1 Region: 415-530
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-33
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 2 Region: 1115-1221
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-33
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 3 Region: 1459-1579
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-33
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 4 Region: 252-356
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 5 Region: 1638-1746
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-32
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 6 Region: 934-1055
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-31
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 7 Region: 1804-1922
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-29
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 8 Region: 1990-2093
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-28
Family Spermadhesin, CUB domain 0.00088
Further Details:      
 
Domain Number 9 Region: 75-185
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-28
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 10 Region: 767-876
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-27
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 11 Region: 594-703
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1288-1397
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-22
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 13 Region: 2343-2411
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.83e-20
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 14 Region: 2583-2651
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-18
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 15 Region: 2400-2469
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.64e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 16 Region: 2700-2766
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.7e-17
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 17 Region: 2760-2829
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.78e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 18 Region: 12-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000104
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 19 Region: 2458-2528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 20 Region: 2818-2875
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 21 Region: 2157-2226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000278
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 22 Region: 2636-2698
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000542
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 2521-2577
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000834
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 24 Region: 191-255
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000138
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 25 Region: 361-429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 26 Region: 879-948
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 27 Region: 1054-1118
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 28 Region: 2283-2347
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000473
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 29 Region: 536-596
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 30 Region: 2880-2947
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000104
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 31 Region: 1750-1819
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000105
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 32 Region: 1228-1292
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000111
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 33 Region: 1578-1642
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 34 Region: 1404-1467
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000283
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 35 Region: 2095-2168
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000283
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 36 Region: 709-771
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000729
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 37 Region: 1921-1985
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000124
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 38 Region: 2219-2295
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000101
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 39 Region: 2939-2997
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000025
Family Complement control module/SCR domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013292   Gene: ENSTGUG00000012896   Transcript: ENSTGUT00000013443
Sequence length 3238
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:92239007:92570398:1 gene:ENSTGUG00000012896 transcript:ENSTGUT00000013443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTQGGDAIASDTCPDPGIPENGKRVGSDFRVGASVQFSCEDSYVLQGSKSITCQRVTDTL
AAWSDHRPICRARTCGSNLRGPSGIITSPNYPVQYEDNAHCVWVITTTDPEKVIKLAFEE
FELERGYDTLTVGDAGKVGDTRTVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFK
AVYQEIEKGGCGDPGIPSYGKRTGSSFLHGDTLTFECQAAFELVGERTITCQQNNQWSGN
KPSCVFSCFFNFTTPSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQFD
YLTIKDDGISDLPPLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNE
CHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCIMQDGNVVWSSTVPRCEA
PCGGHLTASSGVILPPGWPGYYKDSLNCEWVIEARPGHSIKITFDKFQTEVNYDTLEVRD
GPANSSPLIGEYHGTQAPQFLISTGNYMYLLFTTDNSRSSVGFLIHYESVTLESDSCLDP
GIPVNGHRHGNNFNIRSTVTFSCDPGYTLSDEEPLICERNHQWNHALPSCDALCGGYIQG
KSGTVLSPGFPDFYPNSLNCTWTIEVSHGKGVQLFFHTFHLESSHDYLLITEDGSFTEPV
ARLTGSVLPPTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRR
VGFHFGVGDSLIFSCFPGYRLEGANKLTCLGGGRRVWSAPLPRCVAECGATVSGNEGTLL
SPNFPSNYDNNHECIYKIETEAGKGIHLRARSFQLHEGDTVKVYDGKDSSSRSLGVFTKN
DMMGIILNSTSNHMWIEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYKIRDEGHFI
DTVILYSCNPGYTMHGSSIMTCLSGDRRVWDKPLPTCIAECGGRIHAATSGRILSPGYPA
PYDNNLHCTWIIEADPGKTISLHFIVFDTEVAHDILKVWDGPVESSILLKEWSGSALPED
IHSTFNSLTLQFDSDFFISKSGFSIQFSTSIASTCNDPGTPQNGTRYGDSREPGDTTTFQ
CDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKE
CDWRIKVNPDFVIALIFKSFNMEPSYDFLHIYEGEDSNSPLIGSFQGSQAPERIESSGNS
LFLAFRSDASVGMSGFAIDYKEKPREACFDPGNIMNGTRIGTDFKLGSTITYQCDSGYKI
IEPSTITCVIGADGKPAWNRALPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQTCHYSIT
VPKEFVVFGQFAYFQTALNDVAELFDGENSQARLLSSLSGSHSGETLPLATSNQILLRFT
AKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECSPGYLLQGS
KAIRCQSVPNALAQWNDTVPSCVVPCSGNFTERRGTILSPGYPEPYGNSLNCVWKIIVTE
GSGIQIQVISFATEHNWDSLEIYDGGDMTAPRLGSFSGTTVPALLNSTSNQLYLHFHSDI
SVAAAGFHLEYKTVGLAACPEPVIPSNGIKSGDRYMVNDVLSFQCEPGYTLQGRSHISCM
PGTVRRWNYPSPLCIAKCGGTLTNMAGVILSPGFPGNYPSNLDCTWKILLPIGYGAHIQF
LNFSTEANHDFLEIQNGPQHTSSMIGQFSGMELPSPLLSTTHETLVHFYSDHSENRQGFK
LTYQAYELQNCPDPPPFLNGYIVNSDYSVGQSVSFECYPGYVLRGQPVLTCQHGINRNWN
YHFPRCEAPCGYNVTAQNGTVYSPGFPDEYPNSKDCTWLIIVSPGHGIYINFTLLQTEPV
NDYIAVWDGPDHNSPQLGVFSGNTALETAYSSTNQVLLKFHSDFSTGGFFVLNFHAYQLR
KCQPPPTVPHADLFTEDDDFEIGDFVKYSCHPGFTLVGQDILTCKLNAQLQFEGSSPSCE
AQCPANEIRTESSGVILSPGYPGTYPNSQTCSWTIKVEPGYNISIFVEMFQSEKQFDELE
VFDGSSGQSPLLVALSGNHTGQLNFTSKMNQLYLRWSTDHATSKKGFKIRYSAPYCSLNS
NLRNGGILNKTGGPAGSKVRYYCKPGYRMIGQNNATCRRYQNGMYQWDSPVPICHAVSCG
IPESPGNGSVIGNEFTLGSRLIYECNEGFKLESSQQATAVCQEDGLWSNKGRPPVCKSIT
CPSIETLLSERVVWRLISGSLNEYGAQVMLSCSPGYYLLGQRLIQCRTNGTWSVGNERPS
CKVISCGGLPSPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGTETQCL
AGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPI
TCGHPGNPAHGMTNGSEFNLNDVVNFTCNTGYLLQGASRAQCRSNGQWSSPLPNCRVVNC
SDPGFVENAIRHGQQNYPESFKYGTSVAYHCKKGFYLLGSSALTCKANGLWDRSLPKCLS
ISCGHPGVPANAILSGDKFTYGSIIHYSCTAGRRLIGNSTRECQEDSHWSGTLPHCSGNN
PGFCDDPGVPAHGSRLGDEFKTKSLLRFSCEMGYQLRGSAERTCLLNGSWSGVQPVCEAV
SCGNPGTPANGMIIYTDGILFSSSVIYACWEGYKTSGLTTRHCTANGTWTGTAPDCTVVI
NCGDPGALANGIQFGNDFTFNKTVSYQCNPGYLMEPASSSTMRCVKDSTWNQSKPICKAI
TCGPPPTVQYGKVEGSDYRWGASVSYSCAEGYQLSNTAILSCEGRGVWRGDIPQCLPVFC
GDPGTPAEGHLNGKSFTYRSEVSFQCRPPFILIGSSRRFCQADGTWSGIQPTCIDPAHNT
CTDPGTPHFGIQNSSRGYEVGSTVYFRCRKGYHIQGSTTRSCLANLTWSGIQSECIPHAC
RQPETPAHVDVKAIDLPTLGYTLVYTCQPGFFLAGGSEHRTCKPDMKWTGKSPICKIHFT
HFAFAHRIVITAVAHFYLVPSDVFFINSLWKGFYEYLGKRQPATLTVDWFNTTSSKVNAT
FIEASNIQLKLSVIGVYKKEEAHLLLKAFQIKGPSDIFVSKYENDNWALDGYVSSGLERG
VFTYQGDIHGKDFGKFMLQRQGPLSADTDLSNHYYGTNSSSVAAAILVPFFALILSGFAF
YLYKHRTRPKVQYNGYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences H0ZRP8
ENSTGUP00000013292 ENSTGUP00000013292 59729.ENSTGUP00000013292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]