SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013304 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013304
Domain Number 1 Region: 113-356
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.97e-31
Family Eukaryotic proteases 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013304   Gene: ENSTGUG00000012918   Transcript: ENSTGUT00000013455
Sequence length 366
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:82944225:82945325:-1 gene:ENSTGUG00000012918 transcript:ENSTGUT00000013455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LILLLCAAKDVMPSSPHWKPTWPSYRVPVILPQSTLNLDKPQFDAEAMLEVVSPCGPACH
KSSPLPTYEEVKNYLSYETLYANGSLTETEVGIYILSNGGDGSRGRSRTKRQIYGYDSRF
SIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGKSYVKGAQKLRVGFLKP
KQKDGGKGSNITNSAMPEKMKFQWIRVKRTHVPKGWIKGNANDIGMDYDYALLELKKPHK
RKFMKIGVSPPARHLPGGRIHFSGYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPGASG
SGVYVRMWKRQNHKWERKIIGIFSGHQWVDMNGTPQDFNVAVRITPLKYAQICYWIKGNY
LDCREG
Download sequence
Identical sequences H0ZRR0
59729.ENSTGUP00000013304 ENSTGUP00000013304 ENSTGUP00000013304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]