SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013307 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013307
Domain Number 1 Region: 418-548
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 354-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000246
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 3 Region: 609-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000129
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 4 Region: 644-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000765
Family EGF-type module 0.009
Further Details:      
 
Domain Number 5 Region: 318-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 799-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000242
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 7 Region: 762-805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family EGF-type module 0.006
Further Details:      
 
Domain Number 8 Region: 726-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 277-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000136
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 687-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000205
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 843-890
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000178
Family Fibronectin type I module 0.065
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013307
Domain Number - Region: 572-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 394-423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0607
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013307   Gene: ENSTGUG00000012921   Transcript: ENSTGUT00000013458
Sequence length 1211
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:53882400:53949804:-1 gene:ENSTGUG00000012921 transcript:ENSTGUT00000013458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSRSTGYFELQLNSVRNVNGELFNGECCDGMKSPENLDCSRDECDTYVKVCLKEYQAKIT
PVGPCNYGFGSTPVLGGNIFYLNSNKYSHQGRTPETGRIVIPFQFAWPRSFTLILEAWDW
DNDTKAGENSLIERVAHAGMINPEDRWKTLQINGPVAHFEVQIRVKCDENYYSALCNKFC
GPRDDFVGHYTCDQNGNKACMEGWMGEECKQAVCKQGCNLLHGGCSVPGECKCHYGWQGQ
FCDECVRYPGCAHGSCNEPWQCNCETNWGGLLCNKDLNYCGNHHPCLNGGTCMNTEPDEY
RCACPDGYSGKNCEIAEHACVSNPCANGGICHEISSGFKCHCPSGWSGPTCAIDIDECAS
NPCAQGGTCIDGINAFECICPQQWIGATCQLDANECEGKPCVNAYSCKNLIGGYYCDCIP
GWTGVNCHININDCHGQCQHGGTCKDEVNGYHCLCPRGFTGKNCEIETNECESNPCQNGG
RCKDLVNGFTCLCSQGFSGVFCEMDIDFCEPNPCQNGAKCYDLGGDYYCACPDDYDGKNC
SHLKDHCKNNSCKVIDSCTIEVFTNTTQEGIRFISSNVCGPHGRCISQPGGNFTCACDRG
FTGTYCHENINDCLGKPCKNGGTCIDEVDSFRCFCSSGWEGELCDTNFNDCSPNPCHNGG
RCIDLVNDFYCECKNDWKGKTCHSREYQCDANTCSNGGTCYDDGDTFRCSCPPEWIGSTC
NTAKNSSCILNPCMNGGTCVGSGDSFSCICKEGWEGRTCTQNTNDCNPHPCYNGGICVDG
VNWFRCECAPGFAGPDCRINIDECQSSPCGYGATCIDEINGYRCTCPPGRIGPRCQEVIG
IGKPCWLKGMTFPHGSRWEQECNSCHCLDGRIDCTKVWCGKKPCLLHKYWDNSNNQCPMG
QECQEKYMKCFQPPCTDWGECSTSEPLPINIKCLPNSGYLDNDCARITLIFNGDKVPQGT
TTENICSEIRYLPATRTVSRDRTLIILCDPSYSTENAVEVAISFVPHRDEQDNSLIQNAA
NTIVNAITKRQNSTVMLAVTEVKVETIVVGNSSSDYLVPILCAVFSIVWLICIIICVWWT
RKRRKERERSRPSREEGANNQWAPLNPIRNPIDRSYSNKDIRYECKNFISPQKRTCDAVE
EYVEYEEEEDEEEERDEEMDKFLSHKLAKPLPTKVSDTSESSPVKKSHQIGKMDNRSVKN
VNASNFEGSRD
Download sequence
Identical sequences H0ZRR3
ENSTGUP00000013307 ENSTGUP00000013307 59729.ENSTGUP00000013307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]