SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013349 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013349
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 5.11e-18
Family Gonadodropin/Follitropin 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013349   Gene: ENSTGUG00000012964   Transcript: ENSTGUT00000013501
Sequence length 61
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:55327968:55328150:1 gene:ENSTGUG00000012964 transcript:ENSTGUT00000013501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPILEPPYIESHHWICTYKETRMVTVKLPRCAPDVDPFYTYPVAICCDCDICSTATTECE
T
Download sequence
Identical sequences H0ZRV5
59729.ENSTGUP00000013349 ENSTGUP00000013349 ENSTGUP00000013349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]