SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013353 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013353
Domain Number 1 Region: 700-1279
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2.35e-204
Family Myeloperoxidase-like 0.000000000344
Further Details:      
 
Domain Number 2 Region: 28-207
Classification Level Classification E-value
Superfamily L domain-like 2.21e-42
Family Ngr ectodomain-like 0.0057
Further Details:      
 
Domain Number 3 Region: 309-404
Classification Level Classification E-value
Superfamily Immunoglobulin 8.92e-28
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 391-486
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-24
Family I set domains 0.008
Further Details:      
 
Domain Number 5 Region: 492-579
Classification Level Classification E-value
Superfamily Immunoglobulin 5.16e-24
Family I set domains 0.02
Further Details:      
 
Domain Number 6 Region: 210-305
Classification Level Classification E-value
Superfamily Immunoglobulin 4.05e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 7 Region: 1379-1437
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000732
Family VWC domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013353   Gene: ENSTGUG00000012962   Transcript: ENSTGUT00000013505
Sequence length 1445
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:95422869:95504832:-1 gene:ENSTGUG00000012962 transcript:ENSTGUT00000013505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPSRCLCFRTTVRCMHLMLESVPAVSPQTTILDLRFNRIKEIQPGEFRRLKNLNTLLLNN
NQIKRIPSGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPESFT
HLPKLERLFLHNNRIAHLIPGTFSHLESMKRLRLDSNALHCDCEILWLAELLKTYAESGN
AQAAATCEYPRRIQGRSVATITPEELNCERPRITSEPQDVDVTSGNTVYFTCRAEGNPKP
EIIWLRNNNELSMKEDSRLNLLDDGTLMIQNTQETDQGIYQCMAKNVAGEVKTQEVTLRY
FESPARPSFVIHPQNTEVLVGESVTLECSATGHPQPRITWTKGDRTPLPNDPRVTITPSG
GLYIQNVKQEDSGEYTCFASNTIDNIHATAYIIVQALPQFTVTPQDKTVIEGQTVDFPCE
AQGYPQPVIAWTKGGGQLSVDRRHLVLSSGTLRISRVALHDQGQYECQAVNIIGSQRIVV
YLTVQPRVTPVFASVPSDMTVEVGTNVQIPCNAQGEPEPVITWNKDGVQVTESGKFHVSP
EGFLTIRDVGTADEGRYECVARNTIGYSSVSMVLSVNVPNVSRNGDPFVQTSIVEAIATV
DRAINSTRTHLFDSRPRSPNDLLALFRYPRDPYTVEQARAGEIFERTLQLIQEHVQDGLM
VDLNGTSYHYNDLVSPQYLNLIANLSGCTAHRRVNNCSDMCFHQKYRTHDGTCNNLQHPM
WGASLTAFERLLKSVYENGFNLPRGIEPRRLSNGYPLPMPRLVSTTLIGTETVTPDEQYT
HMLMQWGQFLDHDLDLTVAALSEARFSDGQHCSSVCTNDPPCFSIMIPPNDPRVRNGARC
MFFVRSSPVCGSGMTSLLMNSVYPREQINQLTSYIDASNVYGSSDHEALEIRDLASQRGL
LRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDQRSNEQLGLTSIHTLWFREH
NRIATELLKLNPHWDGDTIYHETRKIVGAEMQHITFSHWLPKIFGEVGMKMLGEYKGYDP
SVNSGITNEFATAAFRFGHTLINPFLYRLDENFEPIPQGHLPLHKAFFSPFRIVNEGGID
PLLRGFFGVAGKMRVPSQLLNTELTERLFSMARTVALDLAAMNIQRGRDHGIPPYHDFRV
YCNLSSAQTFEDLKNEIKNPEIREKLSRLYGSPLNIDLFPALMVEDLVPGSRLGPTLMCL
LSTQFRRIRDGDRLWYENPGVFTPAQLTQIKQTSLARVLCDNGDNITRVQHDVFKVAEFP
HGYSSCEDIPKLDLRMWQDCCEDCRTRGQFNAFSYHFRGRRSLDYSFQEDKPLKKMKMSK
SVSSVKQSKYFRNATSTSNEKRNVPAVNDFKEFVLEMQKTISSLRNQIKKLESRLSNSDC
TDEEGKSYSSNETWKRDPCTVCECKAGQITCFVESCPPADCEAPVKGKGDCCPVCLQQNT
NKKKP
Download sequence
Identical sequences H0ZRV9
59729.ENSTGUP00000013353 ENSTGUP00000013353 ENSTGUP00000013353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]