SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013421 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013421
Domain Number 1 Region: 305-414
Classification Level Classification E-value
Superfamily ARID-like 2.88e-34
Family ARID domain 0.00031
Further Details:      
 
Domain Number 2 Region: 563-663
Classification Level Classification E-value
Superfamily Chromo domain-like 7.06e-21
Family Chromo barrel domain 0.012
Further Details:      
 
Domain Number 3 Region: 59-113
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000147
Family Tudor domain 0.013
Further Details:      
 
Domain Number 4 Region: 189-288
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000639
Family PWWP domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013421   Gene: ENSTGUG00000013032   Transcript: ENSTGUT00000013574
Sequence length 758
Comment pep:known chromosome:taeGut3.2.4:5:57576962:57617394:-1 gene:ENSTGUG00000013032 transcript:ENSTGUT00000013574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQAADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRLVKVKVVLKGDNSTQLVQDDQVKGPL
RVGAMVETKMPDGSFQEAVISKLTDASWYTVVFDDGDERTLRRTSLCLKGERHFAESETL
DQLPLTNPEHFGTPVIGKKSNRGRRSSLPVTEDEKEEESSEEEDEDKRRLNDELLGKVVS
VTCNSEKADWYPALVVSPSCNDDVTVKKDQCLVRSFADSKFYSIARKDIKELDLQNLPKL
ESSPKKGLQEATTFLSTRGVPRNWKMDISEIMESSTSDEEDGAAAETDEEEQKREEKTEE
VAPEEELDPEERDSFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVYQQGGCDNIE
SGAVWKQIYMDLGIPILNSAASYNVKTAYRKYLYGFEEYCRSANIQFRTIHHNEPKVVEE
TQKHVEPMEESVKEEQKMPPTEVKKEAEENYSSSESEKEEIELRSPRGRRRLARDAAPAK
KEGEEDKTQDKLKDSNKENKDVEETSENAEKKENETPLGKKSTPKQKEKKIKKQEDSDKE
SDEEEERQREREEIENKGESEGEEDEEDTEPCLTGTKVKVKYGRGKTQKIYEASIKSTEI
DDGEVLYLVHYYGWNVRYDEWVKADRIIWPVEKGGPKRKQKKKTKNKEDGEKDEKKDEEK
QKSKRGRPPLKSTLPSNTSCSLPKTPSSEGKFGSREDQTVSDLSPVPEQTKSNSGTSDSE
ADESSEKNLNEEFSPETSELEKSEKLRDEKLDEENPKI
Download sequence
Identical sequences H0ZS27
ENSTGUP00000013421 59729.ENSTGUP00000013421 ENSTGUP00000013421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]