SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013438 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013438
Domain Number 1 Region: 40-791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.77e-282
Family Motor proteins 0.0000000000876
Further Details:      
 
Domain Number 2 Region: 1959-2075
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-25
Family Second domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 2076-2166
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-21
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 4 Region: 1251-1354
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.6e-20
Family First domain of FERM 0.032
Further Details:      
 
Domain Number 5 Region: 1346-1440
Classification Level Classification E-value
Superfamily Second domain of FERM 8.5e-16
Family Second domain of FERM 0.0065
Further Details:      
 
Domain Number 6 Region: 1859-1968
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-16
Family First domain of FERM 0.08
Further Details:      
 
Domain Number 7 Region: 1576-1636
Classification Level Classification E-value
Superfamily SH3-domain 0.000000288
Family SH3-domain 0.0037
Further Details:      
 
Domain Number 8 Region: 793-861
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000956
Family Motor proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013438   Gene: ENSTGUG00000013043   Transcript: ENSTGUT00000013591
Sequence length 2180
Comment pep:novel chromosome:taeGut3.2.4:1:87282592:87341794:-1 gene:ENSTGUG00000013043 transcript:ENSTGUT00000013591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLWFQGDYVWMDLKTGREFDVPIGAVVKLCDSGQIQVVDDEGNEHWISPQNASHIKPMHP
TSIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTYTGSILVAVNPYQLLPIYSPEQIRL
YTNKKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQ
HSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSR
VCRQAQDERNYHVFYCMLRGMTVEQKKKLGLGKATDYNYLAMGNCTTCDGRDDSKEYANI
RSAMKVLMFTDTENWEISKLLAAILHMGNLQYEARTYDNLDACEVVQSASLITAATLLEV
EPQDVMNCLTSRTIITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVEKINAAIYRP
PSQELKSIRRSIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLEN
INWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDATMLHKLNSQHKLNTNYIPP
KNNYETQFGINHFAGIVYYETKGFLEKNRDTLHGDIIQLVHSSKNKFIKQIFQADVAMGA
ETRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGM
METIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQGDLRGTCQRIAEAVLGKDDDWQI
GKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGYKDRSNFLKVRNSVLMIQRYWRGH
NCRKNYGAMRIGFLRLQALYRSRKLHKQYHMARRRIIEFQARCRGYLVRRAFRHRLWAVL
TVQAYARGMIARRLYKRLRGEYYRRLEAEKLRLAEEERLRKEMSAKKAKEEAEKKHQVRL
AQLAREDAEREVKEKEEARRKKELLEKMERARNEPVNDSEMVDKMFGFLGTTSSLPGQEG
QAPNGFEDLEQVQKELEEEDLDAALPLPEEEEEDLSEYKFAKFAATYFQGTTTHTYIRRP
LKQPLLYHEDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGGEKIPVMTKIYETLGKK
TYKKELQALQGEGESTHVDGHKKNSVRHKLVSLTLKKKSKLTEEVTKRLHDGESTLQGNS
MLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQICKQLTQNPSKSSHARGWILMSLCVGC
FAPSEKFVKYLRNFINGGPPGYAPYCEERLRRTFANGTRTQPPSWLELQATKSKKPIMLP
VTFMDGTTKTLLTDSATTAKELCNSLADKISLKDRFGFSLYIALFDKVSSLGSGNDHVMD
AVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHNPSEDNVATNLIYQQIVRGVKFGEYR
CDKEEDLAELASQQYYVDYGSEMVLERLLNLIPSYIPDREITASKTVEKWAQLIIAAHKK
GIYTQKRADPKKVKEEVVDFARFKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFV
DEQEQVLLELSFPEITAVSSSRGGKLQGQSFTLATIKGDEYTFTSNNAEDIRDLVVTFLE
GLRKRSKYVVTLQDNPNPGEESGFLSFLKGDLIVLDQDTGEQVMNSGWANGFNERTKQRG
DFPTDSVYVLPTVTMPPLEIVALVTMTPDQRQDVIRTSQMAVSDSEERVKPYTLEEFSYD
YFRPPPKHTLSRVMITKSRGKDKLWCYTREPIKQPLLKKILGSEELSQEAYSLILDSYLP
PVLKYMGDYPSKRTRSVNELTDQIFEGALKAEPLKDEIYCQTLKQLTDNHIKYSEEKGWE
LLWLCTGLFPPSNILLPHVQRFLQSRKHHPLAADCIQRLQKALRNGSRKYPPHLVEVEAI
QHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNISNRLLLKSSEGFSLFVKISDKVIS
VPEGDFFFDFVRHLTDWIKKARPAKDGIVPSLTYQVFFMKKLWTNTMPGKDSMADSIFHY
YQELPKYLRGYHKCSREEVLQLAALIYRVKFEDDKSYFPSIPKLLKELVPQDLIRQLSPD
DWKRSIVAYYNKHAGKTREEAKLAFLKIIFKWPTFGSAFFEVKQTTEPNYPEILLIAINK
HGVSLIDPKTKDILITHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLT
SYISQMLTAMSKQRSAKGSK
Download sequence
Identical sequences H0ZS43
ENSTGUP00000013438 ENSTGUP00000013438 59729.ENSTGUP00000013438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]