SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013465 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013465
Domain Number 1 Region: 126-258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.32e-44
Family Galectin (animal S-lectin) 0.00000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013465   Gene: ENSTGUG00000013077   Transcript: ENSTGUT00000013618
Sequence length 262
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:58896918:58901682:-1 gene:ENSTGUG00000013077 transcript:ENSTGUT00000013618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSDALGNSNNPAPSQGWPSWGNQPAAPGAFPGYPGAPGAYPGAPGASYPGAPGAYPGAPG
AYPGAPGAYPAPAAPGAFPGYPGAPGAYPGAPGAYPGAPGACPGAPGAYPGAPGAYPGAP
GAYPAKVPFELPLQAGLIPRLLITITGTVNPNPDRFSLDFKRGNDVAFHFNPRFNEDHRK
VIVCNSMFQNTWGKEERTAPRFPFEAGKPFKLQILCETDHFKVAVNDAHLLQYNFREKRL
NEVTKLCIGGDIALTSVLPTMI
Download sequence
Identical sequences H0ZS69
ENSTGUP00000013465 ENSTGUP00000013465 59729.ENSTGUP00000013465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]