SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013490 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013490
Domain Number 1 Region: 571-659
Classification Level Classification E-value
Superfamily PH domain-like 8.36e-19
Family Third domain of FERM 0.0054
Further Details:      
 
Domain Number 2 Region: 385-478
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-16
Family Pleckstrin-homology domain (PH domain) 0.0081
Further Details:      
 
Domain Number 3 Region: 275-326
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000017
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 535-570
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000236
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013490
Domain Number - Region: 23-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0103
Family Ubiquitin-related 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013490   Gene: ENSTGUG00000013098   Transcript: ENSTGUT00000013643
Sequence length 682
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:59734216:59789088:1 gene:ENSTGUG00000013098 transcript:ENSTGUT00000013643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGIRMPDGCYAEGTLELSFFVHVTDLGRDVTLRVTGEIHIGGVMLRLVEKLDVKKDW
SDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDR
VFKAVSDICKTFNIRHPEELSLLRKPRDPSKKKKKKLDDQCEDDTFELEGPLITPGSGNI
YSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPVTSPESLAKMYK
PQTLLDKAKINQGWLDSSRSLMEQEVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQS
KWAILLEEIECTEEEMMMFAALQYHINKLSIMSSENHLNHSDKDVDEVDAALSDLEITLE
GGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKPYWCTFKDTSISCYKSKEESNGTPA
HQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNETQYASWMAACRLASKGK
TMADSSYGMEVQNILSFLKMQHLNPDPQLIPEQINTDINPECLVSPRYLKKYKNKQITAR
ILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFNARFQGGKKDELIGIAYNRLIRMDA
STGDAVKTWRFSNMKQWNVNWEIKMVTVEFADEVRVSFICTEVDCKVVHEFIGGYIFLST
RAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences H0ZS94
ENSTGUP00000013490 ENSTGUP00000013490 59729.ENSTGUP00000013490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]