SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013493 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013493
Domain Number 1 Region: 286-452,493-628
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.67e-58
Family Tandem AAA-ATPase domain 0.00048
Further Details:      
 
Domain Number 2 Region: 58-250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-36
Family SPRY domain 0.0036
Further Details:      
 
Domain Number 3 Region: 5-68
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000304
Family Tandem AAA-ATPase domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013493   Gene: ENSTGUG00000013096   Transcript: ENSTGUT00000013646
Sequence length 740
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:101747413:101765156:1 gene:ENSTGUG00000013096 transcript:ENSTGUT00000013646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FACLTEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
IQIVYETLKDQMEGKKGKATIKTGGAVLNKWQMNPYDRGSAFAIGSDGLCCQSREIKEWH
GCRATRGVTKGKYYYEVSCHDQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFD
SYGEEFTMHDTIGCYLDTEKGQIKFSKNGKDLGLAFEIPPHIRNQALFAACVLKNAELKF
NFGEEDFKFPPKDGYVGLCKAPEGSVVKSQHSGNAQVVQAQNLPNAPKALIVEPSRELAE
QTLNNVKQFKKYVDNPKLRELLIIGGVAARDQLSVLEQGVDIVVGTPGRLDDLVSTGKIN
LSQVRFLVLDEADGLLLQGYSDFINRIHSQIPQITSDGKRLQVIVCSATLHSFDVKKLSE
KIMHFPTWVDLKGEDSVPETVHHVVVPVNPKTDKLWERLGKNHIRTDEVHAKDNTRPGAN
TPEMWSEAIKILKGEYTVRAIKEHKMDQAIIFCRTKIDCDNMEQYFIQQGGGPDRKGHQF
SCVCLHGDRKPQERKQNLERFKRGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
HRIGRVGRAERMGLAISLVAKEKEKVWYHVCSSRGKGCYNTRLKEEGGCTIWYNEMQLLG
EIEEHLNCTIAQVEPDIKVPVDDFDGKVTYGQKRALGGGLYKGHVDILAPTVQELAALEK
EAQTSFLHLGYLPNQLFRTF
Download sequence
Identical sequences H0ZS97
59729.ENSTGUP00000013493 ENSTGUP00000013493 ENSTGUP00000013493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]