SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013518 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013518
Domain Number 1 Region: 535-719
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-34
Family YWTD domain 0.00000107
Further Details:      
 
Domain Number 2 Region: 2-106
Classification Level Classification E-value
Superfamily GFP-like 8.06e-26
Family Domain G2 of nidogen-1 0.00017
Further Details:      
 
Domain Number 3 Region: 259-371
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 8.5e-22
Family Thyroglobulin type-1 domain 0.00081
Further Details:      
 
Domain Number 4 Region: 150-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000377
Family EGF-type module 0.038
Further Details:      
 
Domain Number 5 Region: 222-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000187
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013518
Domain Number - Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00042
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013518   Gene: ENSTGUG00000013119   Transcript: ENSTGUT00000013671
Sequence length 731
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:59965367:59974330:1 gene:ENSTGUG00000013119 transcript:ENSTGUT00000013671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLNLRTHIQGEVPFLPENVTIHITPYEELYSYSSSAVTSSGQREYVVAAGTANQTVSYRL
RQNITFSGCPHSRPPARQRLSVARAFALFDSHEHVLRYALAARIGPARGDAANPGVSPCQ
DGSHTCQAPARCQPGVGTEYTCECAAGYRPDGHGCRDVDECAEGLSQCGPFSECRNVPGT
YRCECRGGYGPAGDGQACVPLAPAGDPCEDGRHPCAPGDGPRARCLSRGDGRATCECLPG
YSGDGIHCSDVDECAESPCHPAAICYNTLGSFSCRCQPGYAGDGFQCTYGEVPAQPRNPQ
RLRPCQHERMYPREVPPLGDGHAPQCDEQGRYRPLQCHGSSGHCWCVDAAGQEIAGTRTA
PGTTPPRCGSPGQTPPGGDQGWLLGRLAGVPMASHLGPAARSVGTAWPLPQTKGCWKMGE
VVPSGSGGAAQVCPRPQCHLPKATSSAQVCPRPQCHLPKATSALPITHPGWNNNLFLLPL
LISICIEFHNRSCIFILLILHYTHSYFFQKVQKELLGRSILSVSRDPGAAFPQRGHVPAG
LISPEGLAVDHLRRAMFWTDSGLDRIERARLDGSERRVLFHSELVNPRAIAVDPVRGNLY
WTDWNREAPKIETSTVNGANRRVLVHSDIGLPNGLTFDPFSKLLCWADAGTKHLECTFPD
GSGRRVIQSNLNYPFSIVSYANHFYHTDWRRDGVIAVNKETGSFTDEYLPEQRSHLYGIT
AVYPYCPGGKI
Download sequence
Identical sequences H0ZSC2
59729.ENSTGUP00000013518 ENSTGUP00000013518 ENSTGUP00000013518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]