SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013530 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013530
Domain Number 1 Region: 118-226
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-28
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 2 Region: 228-374
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-23
Family Third domain of FERM 0.0025
Further Details:      
 
Domain Number 3 Region: 16-118
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-16
Family First domain of FERM 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013530   Gene: ENSTGUG00000013134   Transcript: ENSTGUT00000013684
Sequence length 542
Comment pep:novel chromosome:taeGut3.2.4:5:60032164:60043338:-1 gene:ENSTGUG00000013134 transcript:ENSTGUT00000013684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLPFHNNRVMQDRRSVCIFLPNDDSLNIIINVKILCQELLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMDLAQKLYKYCPKEWKKEASKVLHGELTAGIDQFGPPMIIHFRVQYYVENG
RLISDRTARYYYYWHLRKQVLHSQCVLREEAYFLLTAFALQADLGDFKRNKHYGKYFEPE
AYFPAWVVAKRGKDYILKHVPNMHKDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDK
REVEASLTLGLTTRGIQIFQNLDEEKQLLYDFPWTNVGKLQDWGKKFEILPDGLPSARKL
IYYTGCPLRSRHLLQLLSSSHRLYMNLQPVLRQVRRLEENEEKKQYRESYISDTLDLDME
QLEKRSRASGSSAGSIRHKRLSRHSTASHSSSHTSGIEADPKPREMGPEDGFSGAGAHRK
LKTCSSMTSHGSSHTSGVESGGKERLEEDSQDDEIEMLVDDPRELERAGEMEVSPDMCVY
ITEDMLLSRKFNGHSGLIVKEISSSTSSSSETVVKLRGQSTDSLPQTTCRKPKTSTDRHS
LS
Download sequence
Identical sequences H0ZSD4
ENSTGUP00000013530 ENSTGUP00000013530 59729.ENSTGUP00000013530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]