SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013533 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013533
Domain Number 1 Region: 352-508
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-37
Family SPRY domain 0.0045
Further Details:      
 
Domain Number 2 Region: 165-260
Classification Level Classification E-value
Superfamily Fibronectin type III 6.12e-18
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013533   Gene: ENSTGUG00000013140   Transcript: ENSTGUT00000013687
Sequence length 517
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:60191711:60232403:1 gene:ENSTGUG00000013140 transcript:ENSTGUT00000013687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQ
LLSRVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRV
HLTEDQWGKGTLTPRMTTDFDLNLDNAPLLQSIHQLDFVQMKVSSPVPAPPILQLEECCT
HNNSATLSWKQPPLSTVQVEGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYSALV
KAFNKSGVSPYSKTLVLQTSEEKGQAASSPMPDTQSEEQTLPFPVPLERSQLRRMSPFSS
TLNLQPSFSGRSYFELRSSAHQLSLHSSLQSLNSAGCNFDTQGSPYSQLGKIDIKKMVAV
AWFSFDPSSAHADIIFSNDNLTVTCNSYDDRVVLGKTGFSKGLHYWELSIDRYDNHPDPA
FGVARIDVLKDAMLGKDDKAWAITEGGITKGATVGVLLDLTRRTLTFSINEDQQGPVAFE
NLEGLFFPAVSLNRNVQVTLHTGLPVPEFYASRSAMP
Download sequence
Identical sequences H0ZSD7
ENSTGUP00000013533 59729.ENSTGUP00000013533 ENSTGUP00000013533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]