SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013571 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013571
Domain Number 1 Region: 4-226
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.92e-88
Family Eukaryotic proteases 0.000000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013571   Gene: ENSTGUG00000013177   Transcript: ENSTGUT00000013726
Sequence length 228
Comment pep:novel chromosome:taeGut3.2.4:1:89011980:89014807:1 gene:ENSTGUG00000013177 transcript:ENSTGUT00000013726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDDDKIVGGYTCGKNAVPYQVSLNSGYHFCGGSLISSQWVVSAAHCYKSRIQVQLGKHNL
ETTESTQQLINSAKVIRHSGYSPYTLDNDIMLIKLATPATLNKAVQTIPLPTSCVATGTT
CLISGWGNTLSSGSNYPDQLQCLNAPVLSAAECSDAYPGQITNNMMCVGFMEGGKDSCQG
DSGGPVVCNGELQGIVSWGLGCAQEGYPGVYTKVCNYVSWIQSTIASH
Download sequence
Identical sequences H0ZSH5
ENSTGUP00000013571 ENSTGUP00000013571 59729.ENSTGUP00000013571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]