SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013577 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013577
Domain Number 1 Region: 52-147
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.22e-30
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00013
Further Details:      
 
Domain Number 2 Region: 131-246
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.46e-26
Family UBX domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013577   Gene: ENSTGUG00000013185   Transcript: ENSTGUT00000013733
Sequence length 290
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:106989071:107002343:1 gene:ENSTGUG00000013185 transcript:ENSTGUT00000013733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNIKTVKKEWVCKSGTDDQILNGTEQNCDYFVDNLFEEAQKVAAMCVPPTTVKNQVDVI
IKLWKNGFTVNDGELRGYADVANQQFLESIKKGELPFELQKVFDKEEVEVKVEDKKDKVY
LSSKKPMFHPFSGHGYRLGSATPKIISKVRDDHPGPDDKRHLPLVPLNDLEPITNVQIWL
ADGERIIQKFNVSHRISHVRDFITKYQGSEGGVPFTLTTSLPFRELQDETLTLEEAKLEN
AVVVQRLRKTTEPFRLLVIKAPDNDYKSAATPNGQLKNEQKNAINSTRSN
Download sequence
Identical sequences H0ZSI1
59729.ENSTGUP00000013577 ENSTGUP00000013577 ENSTGUP00000013577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]