SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013600 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013600
Domain Number 1 Region: 8-215
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.35e-43
Family DsbA-like 0.00000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013600   Gene: ENSTGUG00000013205   Transcript: ENSTGUT00000013756
Sequence length 220
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:89362851:89369970:1 gene:ENSTGUG00000013205 transcript:ENSTGUT00000013756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARMCRTLVELFYDVISPYSWLAFEALCRYRHIWNIDLRFRPAFLGGIMQQTGNKPPAMLP
KRGEYMLKDLKRMAKYYQVPVHMSPDAFQHIMGTSSLTAMRFITAIDMTNPQYLEPLSRE
FWIRFWSQHEDISQPESILAVAQQAGLSAELSQKALEMISSPTVKDRLKDTTAEVLKYGA
FGMPAVVAHYDGEPHLFFGSDRLELLGSILGEKWLGPVPS
Download sequence
Identical sequences H0ZSK4
ENSTGUP00000013600 59729.ENSTGUP00000013600 ENSTGUP00000013600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]