SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013613 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013613
Domain Number 1 Region: 505-678
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-41
Family MAM domain 0.00028
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 202-300
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000017
Family I set domains 0.037
Further Details:      
 
Domain Number 4 Region: 107-188
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000222
Family I set domains 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013613
Domain Number - Region: 332-494
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00144
Family Fibronectin type III 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013613   Gene: ENSTGUG00000013218   Transcript: ENSTGUT00000013769
Sequence length 715
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:61182423:61276227:1 gene:ENSTGUG00000013218 transcript:ENSTGUT00000013769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASPSIKLLVDDPIVVNPGEAITLVCVTTGGEPVPSLTWVRSAGVLPDKTVLNGGTLTIPA
ITSEDSGTYSCIANNNVGNPAKKSTNIIVRALKKGRFWITPDPYHKDDNIQIGREVKISC
QVEAIPSEELTFSWFKNGRPLRSSERMVITQTDPDVSPGTTNLDIIDLKFTDFGTYTCVA
SLKGGGISDISIDVNISSSTVPPNLTVPQEKSPLVTREGDTIELQCQVTGKPKPIILWSR
ADKEVAMPDGALQTESYDGILRIVNVSREMTGTYRCQTSQYNGFNVKPREALVQLIVQYP
HPIKADFRITQRQGWLWVSSLVESLVVFLVDSSRILKVAWRWWEQEITVNGNIQKGELIT
YNLTELIKPEAYEVRLTPITRFGEGDSTIRVIKYSAQQPNFRYKTSKEISYFLRHIYLYG
YKWQRNDFKHCHSFLWSEAKSQNAGQQRWWEQEITVNGNIQKGELITYNLTELIKPEAYE
VRLTPITRFGEGDSTIRVIKYSGKFHWGFEDGNICLFTQNDTNNFDWTKQSTATRDTKYT
PNTGPNADRTGSKEGFYMYIETSRPRLEGEKARLVSPVFNVAPKNPYGATNTAYCFSFYY
HMYGQHIGSLNVYLRLKGQTAIENPLWSSSGNKGQHWNQARVNINPPTSFQLIFEGIRGP
GIEGDIAIDDVSIVEGECMKSDQPANNLRSGAVGPLAHIRLLPLLILMSVLSHQR
Download sequence
Identical sequences H0ZSL7
ENSTGUP00000013613 ENSTGUP00000013613 59729.ENSTGUP00000013613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]