SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013614 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013614
Domain Number 1 Region: 25-212
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.08e-50
Family Astacin 0.00028
Further Details:      
 
Domain Number 2 Region: 381-544
Classification Level Classification E-value
Superfamily TRAF domain-like 8.99e-36
Family MATH domain 0.001
Further Details:      
 
Domain Number 3 Region: 220-384
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-29
Family MAM domain 0.0045
Further Details:      
 
Domain Number 4 Region: 623-664
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000918
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013614   Gene: ENSTGUG00000013219   Transcript: ENSTGUT00000013770
Sequence length 694
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:108303567:108315547:-1 gene:ENSTGUG00000013219 transcript:ENSTGUT00000013770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGLDLFQGDILLPKDQRNALRNEAYRWKFPIPYILGDDLDLNAKGVILQAFEMFRLKSC
IDFKPYEGERTYIFFSKQEGCWSMVGDLQTGQNLSIGSGCDYRAIVEHELLHALGFYHEQ
SRTDRDDYVNIWWNEIIAGQEHNFVKYDDTFITDLNTPYDYESLMHYEPLSFNKNENVPT
ITAKIPAYNGIIGQRLDFSAIDLERLNRMYNCTSTHTFLDQCSFELENICGMIQGTKHDQ
DWVHQQGSVTGQEDHTLSGHCRDAGYFMYFNTNSGQADEVAILESRILYPKRTQQCLQFF
YRTTGSPSDKLIIWLKEDDGTGNIRKMRKIQTFQADSDSNWKIAHVTLNAQKKFRYLFQG
LKGNPSSSSGGIAIDDVTLTETPCPMAVWVIRNFSKILENSSISMVESPRFYSPEGYGFG
ISVFPNYPYSSYVRVAFHLCSGENDAVLEWPALNHQVTLTVLDQDPDVLKRMSSSKSFTT
SKDHVNSGKRGSIMWDKPSTAGRFDELCNCYRSVNWGWNNFISHSQLRRRNFLKNDDLII
FAEFNELVVVQQELCKGKMDKEHPLHHSLILSPFFKDIIHLNNTEVPVKPVQSALTEGLV
LERRKREAQDVEPIQEQLPYLPDPCDPSPCQNDGVCVIVKGKASCRCPSGRAFFFTGERC
QSRQVHGNILGMLIGGIAGTIVLTIVLISMMARR
Download sequence
Identical sequences H0ZSL8
59729.ENSTGUP00000013614 ENSTGUP00000013614 ENSTGUP00000013614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]