SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013638 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013638
Domain Number 1 Region: 598-891
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.09e-82
Family Protein kinases, catalytic subunit 0.0000000155
Further Details:      
 
Domain Number 2 Region: 17-189
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.34e-61
Family Ephrin receptor ligand binding domain 0.0000126
Further Details:      
 
Domain Number 3 Region: 315-518
Classification Level Classification E-value
Superfamily Fibronectin type III 2.23e-30
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 889-956
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.18e-19
Family SAM (sterile alpha motif) domain 0.0013
Further Details:      
 
Domain Number 5 Region: 244-309,353-365
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000471
Family Growth factor receptor domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013638   Gene: ENSTGUG00000013242   Transcript: ENSTGUT00000013794
Sequence length 957
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:89604941:89641017:-1 gene:ENSTGUG00000013242 transcript:ENSTGUT00000013794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLWALLPPEAHGKEVDLLDTSTAQGELGWLPDPPEVGWSEVQQMINGTPIYMYQDCSV
LSEGDTDHWLRTNWIYRGEAASRVYVELKFTVRDCKSFKGEVVTCKETFNLYYMESEQDV
GIQFRRPLFTKLNTVAADRSFTSRDIESGAMQLNTEVCPIGKLSRRGFYLAFQNSGACVA
MVSVRVYYKTCPEAVRGLARFPETLAGSEGLTEVPGVCVEYAAEEVGSPPRMHCSTDGEW
LVPVGRCLCAVGFEEVDGSCVACQRGFYRHSLDAKRCLKCPPNSLSNESGATSCSCNAGF
YRAPSEGQNIACTRPPSAPRNVSFSLLGTQLSLWWQPPSDHGGRKDLTYTVFCQRCHFLS
CEPCEAGVVFSPSASGLTKPAVDVDGLEAYTNYTFTVEAHNGVSGMGPAPQRTAPAVWVS
VGHAAPVTVSQFILTQRDDSSLSVSWLAPRQRSRTSVEYEVMFFEKGEEARYTVKHLLEP
NVTLRDLQPDTAYLLRVRSITPLGPGPYSPEQEFRTLPPDTGALSGGVIVSIIFGVLLFI
GLVVGFLMFRRKRARRRHARPDYNTSGFERGEKVWLKPYVDLQPYDDPSRGVLEFTKELD
VSCVTMENVIGEGEFGEVYRGSLRLPGKERIVVAIKTLKSTYSDSQWWNFLREATIMGQF
NHPNIVRLEGVVTKRRPMMIITEYMENGALDTFLRENEEKFSPVQLVSMLQGIASGMTYL
SEHNYVHRDLAARNILVTRSLQCKVSDFGLSRILENDAEGTYETKGGKIPIRWTAPEAIA
HRIFTSASDVWSFGIVMWEVLSFGDKPYGHMTNQEVMKSLEDGYRLPPPVDCPSILYELM
KSCWSHDRMRRPHFQEIRAQLQHFISSPQLLRPVADFDPRVTLRLPSCSGSDGIPYRSIP
EWLESIRMKRYISNFRTAGLDTMESILELTAEDLKQMGVSLPGHQKRILCSIQGFKE
Download sequence
Identical sequences H0ZSP2
ENSTGUP00000013638 ENSTGUP00000013638 59729.ENSTGUP00000013638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]