SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013640 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013640
Domain Number 1 Region: 100-247
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.04e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.00000218
Further Details:      
 
Domain Number 2 Region: 19-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.26e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013640   Gene: ENSTGUG00000013246   Transcript: ENSTGUT00000013796
Sequence length 251
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:108557644:108607020:1 gene:ENSTGUG00000013246 transcript:ENSTGUT00000013796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDSVAANGEGKDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKP
ADLHNLAPGTHPPFLTFNGEVKTDVNKIEEFLEEILAPPKYPKLAAKHRESNTAGIDIFS
KFSAYIKNTKQQDNATLERGLVKALKKLDDYLRTPLPEEIDADSTEEEKVSKRKFLDGDE
LTLADCNLLPKLHVVKIVAKKYRNFEFPAEMTGLWRYLKNAYTRDEFTNTCAADKEIEQA
YADVAKRLSKS
Download sequence
Identical sequences H0ZSP4
ENSTGUP00000013640 59729.ENSTGUP00000013640 ENSTGUP00000013640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]