SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013650 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013650
Domain Number 1 Region: 303-535
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.87e-23
Family Clostridium neurotoxins, the second last domain 0.036
Further Details:      
 
Domain Number 2 Region: 122-236
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000271
Family Cadherin 0.0033
Further Details:      
 
Domain Number 3 Region: 15-134
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000357
Family Cadherin 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013650   Gene: ENSTGUG00000013253   Transcript: ENSTGUT00000013806
Sequence length 931
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:89755799:89767880:-1 gene:ENSTGUG00000013253 transcript:ENSTGUT00000013806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSIPYPKSAPANKHKPWIEAEYQGIIMENDNTVLLNPPLFALDKDAPLRYAGEICGFRIH
GSGVPFEAVILDKATGEGLIRAKEPVDCEAHKEHTFTIQAYDCGEGPDGANTKKSHKATV
HVRVNDVNEFAPVFVEKLYRVAVTEGKLYDRILRVEAIDGDCSPQYSQICYYEILTPNIP
FLIDNDGNIENTEKLQYSADRVYKFTVTAYDCGKKRASDDAEVEIQVKPTCKPSWQGWNK
RIEYTPGAGSLALFPTIHLETCDEPLWNIQATVELQTNHVAKGCDRDNYSEKSLRKLCGA
ASGEIDLLPVPSPTANWTARLSVHYSQDSSLIYWFNGSQAAQVPVVNGPNGHEGLSDHFT
LSVWMKHAVVPSKGRREEETVICSTVRSEDGYSHYSLAVHGCRISFLYWPLLESARPVKF
LWKLEQVCDDEWHHYALNLEFPTVTLYVDGVSYDPALIHDNGLIHPPRPEPSLMIGACWA
EEKTKEKTKGSENATDSVQGDPLSIHHYFHGYLAGFTVRPGSLESREVIECLYACREGLD
YSDFDSLGKGMKVHVNPSQSLLTLEGDDVETFNHAIQHVAYMNSLRFATPGVRPLRLTTA
VKCFSEESCVSIPDVEGYVVVLQPDAPQILLSGNAHFAHPASDFEAPEGIPLFPNLQITC
SISHQVEAKKDENWHGTVTDTRMSDEIVHNLDGCEISLVGDDLDPEREYLLLDGALLQQR
GLELVNTSAYLTITGVESIAVYEEILRQVSYHINHGAALYERKFHLSCTEMNGRYSSNEF
TVEVNVLHNMNRAAHPNHILSSQQFVHRGHHLPAELSGHSLASTHNNPMVPSAATVIIVV
CVGFLALMVILGILRIHSLHRRGMGQEVPGAADTGGKESDMFWDDSALTIIVNPMESCQE
RAAGSVEGRTGEGVEDDDDSTDSETPDSPDS
Download sequence
Identical sequences H0ZSQ4
ENSTGUP00000013650 ENSTGUP00000013650 59729.ENSTGUP00000013650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]