SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013717 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000013717
Domain Number - Region: 160-186
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00206
Family Ovomucoid domain III-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013717   Gene: ENSTGUG00000013326   Transcript: ENSTGUT00000013875
Sequence length 225
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:90149293:90150804:1 gene:ENSTGUG00000013326 transcript:ENSTGUT00000013875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLALQNDEAVLVLCYAVLEGNCLSSMLTMAWKEMEKRVFGFGDSVCDSLGRLHMDLCPD
CAFCSLKREQCHNIKTLNRIPCDSGSFSTYINPQISAQNRHAEGKSRSSQTPVDYNMDFL
KGVRMEYWCSRMAIYGCQDPAVSLWLKAEYGTFPDMEGSGKICDSSGVQHPHYCMFKSYQ
CLLKSIYNEKVFRVECQQNKSYRVLSVREGDKEVQLWQERFQDLA
Download sequence
Identical sequences H0ZSX1
ENSTGUP00000013717 ENSTGUP00000013717 59729.ENSTGUP00000013717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]