SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013727 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013727
Domain Number 1 Region: 960-1231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.71e-72
Family Tandem AAA-ATPase domain 0.0000261
Further Details:      
 
Domain Number 2 Region: 702-958
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-54
Family Tandem AAA-ATPase domain 0.0000682
Further Details:      
 
Domain Number 3 Region: 465-512,539-585
Classification Level Classification E-value
Superfamily Chromo domain-like 7.14e-18
Family Chromo domain 0.013
Further Details:      
 
Domain Number 4 Region: 603-676
Classification Level Classification E-value
Superfamily Chromo domain-like 1e-16
Family Chromo domain 0.0054
Further Details:      
 
Domain Number 5 Region: 367-418
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.21e-16
Family PHD domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013727
Domain Number - Region: 173-213
Classification Level Classification E-value
Superfamily HMG-box 0.00113
Family HMG-box 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013727   Gene: ENSTGUG00000013329   Transcript: ENSTGUT00000013885
Sequence length 1921
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:90186792:90206177:1 gene:ENSTGUG00000013329 transcript:ENSTGUT00000013885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGIGSPSPCSGGSDDDEMEILLNNAIPQHPEPEEEPEEELLSEADTPKIKKKKKPKKL
KEPKVPKLSKRQKKEVRKRMPKLGDSSGEGNEFVKEEEEVLRSDSEGSDYTPGKKKKKKL
GPKKEKKNKAKRKEEEEEEEEDDDSKEPKSSAQLLEDWGMEDIDHIFTEEDYRTLTNYKA
FSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVESM
VTNVDAVLPQPPVDVPLRKAKTKEGKGPNARRKPKASPRIPDIKKPKTKKVAPLKIKLGG
FGSKRKRSSSEDDDLDVESDFDDASINSYSVSDGSTSRSSRSRKKLKAGKKKKKGEEDST
VAVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGI
QWEAKEDNSEGEEILEDVVGDAEEEDDHHMEFCRVCKDGGELLCCDACPSSYHIHCLNPP
LPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPVGPAPPRPPDADPNAPPPKPLEGRP
ERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGEEEKSRKRK
NKDPKYAEMEERFYRYGIKPEWMMIHRILNHSVDKKGNVHYLIKWRDLPYDQASWESEDV
DIQDYDLYKQAYWNHRELMRGEEGRPGKKLKKVKMRKLERPPETPTVDPTVKYDRQPEYL
DVTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFL
VSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFTFEDNAIRGGKKASRMKK
EAAVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLL
LTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLK
ADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCC
NHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKML
DLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATAD
TVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVV
RPGLGSKTGSMSKQELDDILKFGTEELFKDEATEGGDNKEGEDSSVIHYDDKAIERLLDR
NQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVDPDYWEKLLRH
HYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDYSVASEEGDEDFDER
SEAARRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFT
TQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMS
LIRKKVQEFEHVNGRWSMPELAEIEENKKLSQPSSPSPKTPTPSTPGDTQPNTPAPVPPP
EDGVKVEEGASTKEQGEPSEPEKELSASTTETEAPMEVNNPLCAQPGETPPQEAKSPVNS
TEADEKKVEETEVKERPDEPMEVESKGTKHLQNTATENPPDPPIITLDEKDEKKDDDKRD
VVMLQNGEMLKDSVDERHKKAVKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
RRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLE
QALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVL
HKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRSSEPPPPPPPQ
Q
Download sequence
Identical sequences H0ZSY1
ENSTGUP00000013727 ENSTGUP00000013727 59729.ENSTGUP00000013727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]