SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013824 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013824
Domain Number 1 Region: 1287-1444
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.77e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000139
Further Details:      
 
Domain Number 2 Region: 1132-1287
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.81e-53
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000417
Further Details:      
 
Domain Number 3 Region: 339-523
Classification Level Classification E-value
Superfamily Cupredoxins 5.74e-49
Family Multidomain cupredoxins 0.0000166
Further Details:      
 
Domain Number 4 Region: 808-982
Classification Level Classification E-value
Superfamily Cupredoxins 2.25e-42
Family Multidomain cupredoxins 0.0000356
Further Details:      
 
Domain Number 5 Region: 20-194
Classification Level Classification E-value
Superfamily Cupredoxins 2.48e-42
Family Multidomain cupredoxins 0.00000257
Further Details:      
 
Domain Number 6 Region: 994-1131
Classification Level Classification E-value
Superfamily Cupredoxins 3.51e-35
Family Multidomain cupredoxins 0.00000887
Further Details:      
 
Domain Number 7 Region: 531-669
Classification Level Classification E-value
Superfamily Cupredoxins 4.73e-35
Family Multidomain cupredoxins 0.00025
Further Details:      
 
Domain Number 8 Region: 197-319
Classification Level Classification E-value
Superfamily Cupredoxins 3.62e-33
Family Multidomain cupredoxins 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013824   Gene: ENSTGUG00000013426   Transcript: ENSTGUT00000013983
Sequence length 1460
Comment pep:novel chromosome:taeGut3.2.4:1:96227452:96260307:1 gene:ENSTGUG00000013426 transcript:ENSTGUT00000013983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLGSWWPDSEQHVVGAVKIREHYIAAQITSWTYKPEPEEKSRLEHSGPVFKKISYREYE
VDFKKEKPANTFTGLLGPTLHAEVGDTLVVHLKNMADKPVSIHPQGLVYSKNEEGSLYDD
RTSSAEKRDDAVLPGQLYTYVWDISEEVGPGEADLPCLTYAYYSHENMAMDFNSGLIGAL
LICKKGSLNEDGSQKHFDREYVLMFGVFDENKSWQKSASVKYTINGYTNGMLPDLEACAY
DNISWHLIGMSSKPEIFSIHINGQSMEQKHRRVSAVNLVGGASTTVNMTVTEEGRWLISS
LVQKHLQAGMHGYLTVRDCGDKEVKKNRLSYRERLMVKTWDYFIAAEEVTWDYAPSIPDT
LDRHYKSQHLDNFSNLIGKRYKKAIFTQYTDASFTKRLENPRPKQTGILGPIIRAQINDK
VRIVFKNKASRPYSIYFHGVTLAKNAEGADYPLDPTSNGTQSRGVEPGNTYTYEWKIAKT
DQPTAQDAQCITRMYHSAVNIERDIASGLIGPLLICKSEALTQKGVQKKADEEQQAVFAV
FDENKSWYLEDNIKEYCSNPATVKRDDPKFYNSNIMHTINGYVSDSSEILGFCRDTVVQW
HFFSVGTHDELVSVRLAGHFFLYQGKYEDTLSLFPMSGESVTVEMDNGGTWLLASWGTPE
MSYGMRLRFRDAKCDYEEDETFDEHQEQSPGRGNYTTNQRRKRRSSLAIKFYSVQKMNTL
LNHVRNKNVSFSGKTDVPLSVHHTENTSNEAMVGTGQLPNEHDDDLEEEGKKMENVIFDD
PYMTDPKVNISRQRDPDDIAEHYLRSRGNKRRYYIAAKEVCWNYAGYKKSAMRNDKTCKD
GSRHKVIFQSYTDSTFSTLQDEDEYTEHLGILGPVIRAEVDDVILVHFKNLASRPYSLHA
HGVLYEKSSEGSVYDDESTAWFKEDEVQPNNSYIYVWYASQRSGPLQSGAACRSWIYYSD
LNLEKDIQSGLIGPILICEKGSFSKSNSSRTYTRDFFLLFMVFDEEKSWYFDKHSGRPCN
EKTREMQQCHKFYAINGITYNLQGLRMYEGETVRWHLMNMGGPKDIHVVHFHGQTFIEQG
EPEHQLGTYTLLPGSFRTIEMKPQRPGWWLLDTEVGEYQQAGMQTSYLVIEKECRIPMGL
ASGVILDSQIDASHHIDYWEPKLARLNNYGTYNAWSTTVEEELPWIQVDFRRQVLLTGIQ
TQGAKQFFKSLYIQKYFLVYSKDKRTWNTFKGDSSPTGKIFEGNSNAYEVKENIIDPPII
ARYIRLYPTEVYNRPTLRMELLGCEVDGCSLPLGMESGEIKNTQITASSTKTSWFNTWDA
SLARLNQNGKMNAWRAKFNNNQQWLQIDLLTVKKITAIATQGVTSMSAENFVKTYVLLYS
NEGSEWKSYIEDSSSMPKVFLGNANSNGHVKNFFNPPILSRFIRIVPKTWYRGIALRVEL
YGCNFGGGLAVKRIDESGRS
Download sequence
Identical sequences H0ZT78
59729.ENSTGUP00000013824 ENSTGUP00000013824 ENSTGUP00000013824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]