SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013876 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013876
Domain Number 1 Region: 614-833
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-54
Family DBL homology domain (DH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 825-922
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000394
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1289-1526
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000577
Family WD40-repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013876   Gene: ENSTGUG00000013476   Transcript: ENSTGUT00000014035
Sequence length 1542
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:98892057:98918274:-1 gene:ENSTGUG00000013476 transcript:ENSTGUT00000014035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYGIYRSPSFGASDGLSWGQPGVRVPPKLPQSGSESLHQPGLEGEQAKHRKSLSNPDIAT
ETLTLLSFLKSDLSELKVKKKGVRIGLDVGSDGCSSVASPSPGSCGAAHPQNRWAPGERP
TLKDLTATLRRAKSFTCSEKSGTRRLFLQSTMKQSSSELLLASTDGQDQDPLPMVIQDQY
IQEARQVFEKISRMGSQQDYGFAAEQKDSGGENLAHSKSAEELSGHESSVTDEGIVTEPE
PVGMRFQALHAAVDTWMLPSAGPAAGDSETLLPARPTAAVEDLPAGKPEMPSTPGSLRRR
RKFPSAGANGMEGGSEGGTEPYRSLSDPMPHRRRSVAEEAKNFSVDSNLLGSLSAKAGIP
QPAAIAGSAGSAGSDLSLGSDGPRDYSSLIRTIVSQPGAMAKLGDDKANGKTIKKKSLSD
PSRRGELAPGAFEGPGEAISELEPSIPPSSSEPILSAQPAAPGTGRGYGFDPKLADVLSP
RIARRSSKKRSNRAAHQENQPPPAPAILAKSRPATKHVRHTSEPATFVPITVPESLVPSG
TTATSLRAGRSPGKSFPTLQPPSLEDVTKRYMLALNSGDMSPSPGDGPRSPPAAPPPQLP
RPSAAGRPLAANPTPKVGECSRPERDMRKHVIMTLLDTEQSYVESLRTLMQGYMKPLKQP
ENSLLCDPSLVDEIFDQIPELLEHHEQFLEQIHDCVQNWHEKQKVGDLLVQSFSKDVLVN
IYSAYIDNFLNAKDAVRIAKEARPAFMKFLEQSMRENKEKQALSDLMIKPVQRIPRYELL
VKDLLKHTPEDHPDHPFLIDAQRNIKQVAERINKGMKSAEEVERNARIVQEIESHIEGME
DLQAPLRRFLRQEMVVEVKAVGGKKDRSFFLFTDLLVCTTLKRKSGSLRRSSMSLYTAAS
VIDTASKYKLLWKLPLEDVDIVKGASQATNRESIQKSISRLDEDLNTLGQVSKLSETLSF
PHQGLDDVIKDLMAAIHRELSEKQSLSFSMAFPPNKVELSTTKADGTESFIFEFPNPDAR
LGFEQAFEDAKKKLAASKNCLDPEFLKAIPIMKTRSGMQFSCASPSHGSPESSHEVWVCN
SDGYVGQVCLLSIRKEPTVEACIAVCSARILCIASVPGLKRAYSCFSPLPPSLPGRGRER
AEPLGSPSAELGPAPPEDAGPQPCLHISISGSSLELSEPVDGGNRELVPFDSDDTDDESS
PSPSGTLHSQASHSTISSSFGNEEISSCKEAAVETTSSEEEQEPGFMPITGTYGQSRHGE
SPTDGRALRRSSRGSFTRGSLEDLLSLDPEAHQSSMWLGTEDGCIHVYQSSDNIRNRKNS
MKMQHAAAVMCILYLDNQVFVSLANGELVVYQREAGRFWDPQNSKYLPVPGLTGEPPPRW
GGVAGKLWCGCQNRVMVLNTTTLAQEHTLQVGQDGGRSVTCMVSAGSGVWVALQGSAQVR
LYHATTYEQLAEADITPPVHKMLAGSDAIIRQHKAACLRITALLACKDLLWIGTSAGVVL
TLAVSPKAAPTLVGLSQGHTGHVRFLTAIELPDGFDVLFPLP
Download sequence
Identical sequences H0ZTD0
59729.ENSTGUP00000013876 ENSTGUP00000013876 ENSTGUP00000013876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]