SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013952 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013952
Domain Number 1 Region: 768-1021
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.61e-88
Family Eukaryotic proteases 0.000000732
Further Details:      
 
Domain Number 2 Region: 344-501
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-35
Family MAM domain 0.0025
Further Details:      
 
Domain Number 3 Region: 531-635
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-26
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 4 Region: 231-335
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 5 Region: 677-784
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000458
Family Scavenger receptor cysteine-rich (SRCR) domain 0.017
Further Details:      
 
Domain Number 6 Region: 640-681
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 183-219
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 8 Region: 53-162
Classification Level Classification E-value
Superfamily SEA domain 0.0000392
Family SEA domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013952   Gene: ENSTGUG00000013551   Transcript: ENSTGUT00000014111
Sequence length 1022
Comment pep:novel chromosome:taeGut3.2.4:1:110264958:110364617:-1 gene:ENSTGUG00000013551 transcript:ENSTGUT00000014111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSKQQLEGRHKQLSSFYEIFFASLLAIFVCICVGLIVLSWLSIQELERAEEDVNTHDYVG
IFKIASGTSFTSTLQNSSSADFKVLAFDVEKLLFQMFLYVIFASQYLKNNLPLPMEPVVV
VIFTLYFTKMVTVEKIKNELVLGVVANNPNPTKALKIDVNSIQIIGNFSKMKALAPRQQL
DSECLPPAELCADGATCISKNFFCDGVLNCPDGSDESEKRCAAVCDGKFMLTGTSGFFHS
MNYPKPYNENIVCQWIIVVPQGLSIKLNFTSFETQPYADVLSIFEGLGQNKVLRASLSGT
NLETIYIFSHEATAQFMSDYSENYNGFNATYTAFNESELNNYEKINCTFEDGFCFWIQDL
DDDSDWDRVQGPTFPFMSGPEFDHTFGNFSGYYISTPIRPGFIEERVRILSLPLVPSDTY
CLSFWYFMYGDNVYRLRVSISDEHGQEKIIFKKEGNYGNNWNYGQVTLNETSHFKVIFDA
FKRRGRSDIAVDDTGLTKGKCNEENYVEPTVRPTAATTPLVPTDCGGPVELWEPNSTFSS
ANFPNNYPNLAFCVWYLNAENGKNIQLHFQFFDLESIHDVVEIRDGRGPDSLLLGNTVYT
EKGPLPDVFSTTNQMTVILRTDKSVTRKGFLANFITGYHLISPRACRVDEHQCGSGKCIP
LHNLCDNIPQCEDGSDEAKCMRLLNGSLITEGLVQARVGKMWHLACADDWSGEIADSVCQ
LLGLGDANMSSAVLFTGDGPFVTITKGGKHSLIFTKREHCLDNLVVHLQCNIQSCGKHLS
TQNNGTRIIGGNDARKEAWPWIVSLHFNFQPVCGASLVSDEWLVTAAHCVYGRQLKPSRW
RAVLGLYSQSDLAQPPAAVRNIDRIIINPHYMKQTKDSDIALMHLQHKVQYTDYIQPICL
PEKNQQFLPGIKCSIAGWGNIRNEGPSSNILQEAEVPLLSNEKCQQWMPKYNITENMLCA
GYDMGGIDSCQGDSGGPLTFEDGDKWFLVGVISFGERCALPQRPGVYVRVTMFVDWIKNI
IY
Download sequence
Identical sequences H0ZTK6
ENSTGUP00000013952 59729.ENSTGUP00000013952 ENSTGUP00000013952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]