SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013974 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013974
Domain Number 1 Region: 616-790
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 200-318
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.83e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1-89
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-17
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 
Domain Number 4 Region: 343-492
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-16
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 
Domain Number 5 Region: 107-194
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000982
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number 6 Region: 507-637
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000384
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013974
Domain Number - Region: 820-889
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0062
Family Ras-binding domain, RBD 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013974   Gene: ENSTGUG00000013572   Transcript: ENSTGUT00000014133
Sequence length 890
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:113684565:113695945:-1 gene:ENSTGUG00000013572 transcript:ENSTGUT00000014133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKAGWLDKNPPQGNTHFLKRWVKIDTDYLRYFGSEKDTYSKRLIPVSSISRVSSVGDQKF
EVVTTRNFVFRAENDADRNEWIWTLQQIAEERKSKAAARTSIATELADKSGFLELRGFKH
KLFVVVAGDKVFLYKNAEDYRLGIGITYIEMNVGNVKEVDRRSFELTTPYRIFSFSADSE
QEKEEWVEAMQQSITEALSNSEVAERIWAVESNRFCADCGSPKPDWASINLCVVICKRCA
GEHRGLGPGITKVRSLKMDRKVWTEELIELFQQFGNVMANQFWAANVPPSEAISPSSGSQ
ERRRFLIAKYREGKYRHYHPLFGNQEELDRALCAAVTTSDLAETQALLFCGASVTCDTGD
PQCPTPLALAERSGQRLQMEFLLHNKTSGCHGVGQSSGRLLSALLCCTEFSRRWCTLQDG
VLSYYENDRNTVPNGEIRVEEIVCLPLHSCRAWHSCSGPQEGTFEVYTEADRLYLFGLES
PDSAREWLKSIAKSFVHPCAEELLALDFERLGRLHYKGGLTLECAQEGWFALVGSTLHIC
SEDGRQQEPLQLRKLQELCEGGGKKVGEKAPPTELRHAGRTLYIQGERKLDFLGWVHAIQ
KAASSSGDTLSEQQLTDSDVPLLVDRCIDYITQCGMGQGIYRKSGQNSKTTSLLEVLQRD
ARCVCLKEGEHQVDDVANTLKRFFRDLGDGLFTRRWAPDWLWATALEDEEAKVGEYRQLL
AALPPVNRATLKALINHLFRVQCFSAENQMNTHNLAIVFGPTLFQTDGKDYKAGRVVEDL
ISHYVEIFNVNDQEMKKQQDEITAIMKMREASSSGTQQAGDFICTVYLEEKKTETEQHVK
VSATMTAEELTFEILDRRKIVMKEKDYWSCFEVNEKEEAERPLHYLEKVL
Download sequence
Identical sequences H0ZTM7
ENSTGUP00000013974 ENSTGUP00000013974 59729.ENSTGUP00000013974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]