SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013996 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013996
Domain Number 1 Region: 564-811
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.18e-80
Family Eukaryotic proteases 0.0000676
Further Details:      
 
Domain Number 2 Region: 68-200
Classification Level Classification E-value
Superfamily SEA domain 4.05e-23
Family SEA domain 0.0087
Further Details:      
 
Domain Number 3 Region: 240-335
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000034
Family Spermadhesin, CUB domain 0.0061
Further Details:      
 
Domain Number 4 Region: 453-499
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000103
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 335-445
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000114
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 6 Region: 528-570
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 487-524
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000563
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013996   Gene: ENSTGUG00000013593   Transcript: ENSTGUT00000014155
Sequence length 815
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:114197249:114227351:-1 gene:ENSTGUG00000013593 transcript:ENSTGUT00000014155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPLRKAANISVQVVSAEDKLAKRILARKKHDKLKKKDKLLWNFQNKIILFTLILFILGVV
TWTLLWLFIVQAENKDALYFVGLFRVANIEFLPEYRQKESKEFLSMAQTVQHVMNLVYTT
SSFSKFYKQSTVSEVSNNNNGGLLVHFWIVFVVPQAKGQVLCEDCVAAILKDSIQTSIIN
RTSVGSLQGLAVDMDSIVLSAGLRSDYWSTTGTGTNCMYDLYADQLHEHFPLDTQATSEG
TICYFKLIASVGHVVRLSIVSLQIEADNCITDSLTIYDSLMPIKDKILYRACEPADSLVS
LVSTNNLMLVIFKAAQVKEQKEFHGYFEVITQEKCGKAIVTKEETGYEGRITSPYYPSYY
PPKCLCAWNFQTPQKSLGIALKFHNYTISEKNIKGCERGWWKINERMYCGYYIDHQTVFH
ITSSAASVELQCSSKVSEKPLLVEYGSFDIGQPCPPGHFKCSTGLCIQQMQRCDGINNCF
DESDELSCVVREWNCNSSFAIQDNLLACNGVSDCENGKDEQNCTHSIPCTNHTFKCRNNI
CIRKQYARCDGTVDCADGSDESSCSCGSSKINNLISRIVGGSNTEEGEWPWQVSLHFVGA
AYCGASVISKEWLVSAAHCFQGSKLADPRAWRAHLGMQRQGRATLVSAVRRIVVHEFYNS
RNYDYDIALLQLSAPWPDTMGHLIQPICLPPSSHRARSGDKCWITGWGQKQEADNEGSAV
LQKAEVEIIDQTLCHSTYGIITARMFCAGLSSGKRDGCKGDSGGPLSCQSNGDGKWFLTG
IVSWGYGCGRPNFPGVYTRVSNFAPWIHKYVPSVL
Download sequence
Identical sequences H0ZTP9
ENSTGUP00000013996 ENSTGUP00000013996 59729.ENSTGUP00000013996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]