SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014016 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014016
Domain Number 1 Region: 29-157
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 7.98e-57
Family N-terminal domain of cbl (N-cbl) 0.00000141
Further Details:      
 
Domain Number 2 Region: 244-330
Classification Level Classification E-value
Superfamily SH2 domain 6.54e-47
Family SH2 domain 0.00000406
Further Details:      
 
Domain Number 3 Region: 337-414
Classification Level Classification E-value
Superfamily RING/U-box 9.94e-43
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 4 Region: 159-243
Classification Level Classification E-value
Superfamily EF-hand 2.58e-36
Family EF-hand modules in multidomain proteins 0.0000115
Further Details:      
 
Domain Number 5 Region: 905-947
Classification Level Classification E-value
Superfamily UBA-like 0.0000664
Family UBA domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014016   Gene: ENSTGUG00000013612   Transcript: ENSTGUT00000014175
Sequence length 962
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:116214516:116332474:1 gene:ENSTGUG00000013612 transcript:ENSTGUT00000014175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGRNPRKGRILGFIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPKLQLKNSPP
YILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERM
YEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAADFWRKFFGDKTIV
PWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISIFEFDIFTRLFQPWGSILRNWNF
LAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPH
NKPLFQALIDGSREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQL
CKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPFDPRDEN
SRCCSILDSFSMPMLDLDDDDDREESLMMNRLASVRKCNDRQNSPVTSPGSSPLAQRRKP
LPDPLQIPHLSLPPVPPRLDLIQKGVARSPCASPTGSPKSSPCMVRKQDKPLPAPPPPLR
DPPPPPPERPPPMLPESRSGRHLHHGENLPAREQPVPLEAWCPRDVFGTSQGCQARGDAS
PKAGLTATANLNGRHGRVASEQGFMRKHRRHEPPAESAKVFSNGHLMSEEYDVPPRLSPP
LPAGSVIPSIKCPGPSANSLSDKSREHLDDDDEYKIPSSHPVILSSQPPHGHNIKPLARV
CENGQCTNGTHGATSETKKSKHPESGDVCAAPSVPVPLPPARAPARDNPKHSTLLTRTPS
DYDLLVPPLGEDAFDNSPPSLPPPPPPARHSMIEHTKPAGSGSRPSSGHELFLHSDPHFD
PTIGHVPLPPARRAPGENVKTNRTSQDYDQLPPSSDGSQAPARPPKPLPRRTAPEIHHRK
PYSSDSSTENVDAKIAKLMGEGYSFEEVKRALEIAQNNVDVARSILREFVCFPPPVSPRL
NL
Download sequence
Identical sequences H0ZTR9
ENSTGUP00000014016 ENSTGUP00000014016 59729.ENSTGUP00000014016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]