SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014030 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014030
Domain Number 1 Region: 1030-1145
Classification Level Classification E-value
Superfamily SEA domain 3.27e-19
Family SEA domain 0.0086
Further Details:      
 
Domain Number 2 Region: 245-338
Classification Level Classification E-value
Superfamily SEA domain 0.0000000275
Family SEA domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000014030
Domain Number - Region: 1195-1237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0516
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014030   Gene: ENSTGUG00000013625   Transcript: ENSTGUT00000014189
Sequence length 1372
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:117846259:117884094:1 gene:ENSTGUG00000013625 transcript:ENSTGUT00000014189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGFIWKIFLCLPGMINTDLQMVAAAGRGQAEDAQLSAWQLAKPSLPPGLEKPSGIMDTE
QFHRHLQLRRKRSILFPSGVKICPDESVEQAIANHLKYFRLRVCQETVWEVFKTFWDRLP
EREEYNSWLGLCEEGTMSIFQMGTNFSQSEEHRSLILKKLAYTKEAMGSSCADWSCGGTP
TPPLDADVTTLRDAAANVPPPHEVSVESPAGDAIHEHDNVDTTINNEIKKQDEKLVRPVA
EQMIEFNILIVGEQYSEELKDPSAAEYQLLSERFISQIKSVFEGLPGYKNIHILDYSLYS
SFKDVGVEVHYAVTFDGKAISNATWDLINLHSNKVEDNSFMGIEDNPTVVYTISDFRDYI
AEILQRSALLENASISLDPNSLQLTNVKEILHPTSEDPSWVPEHPVVLERPELDDSTFLA
ERPSADESTVSNALPFDYADSTSDSEQASDNEIQPRPQNADYEAGLAPEAPLPSEVDVTS
LPDGQNLETTHLVTVPVLEHDSVDSLEWLSAPSALDVFTFYTGLSEELLPLSPSHLVPEE
SPSTEDSAVPLLSAPTVASSSVIETDTKEKEEVIQGSPEGSDSADSVEEMPFPLEVPPME
DETDIFLGDRVIYDDGSGSAFDGSGKEMESSIWPWEEATLEPVFYPGPDSWLEDDNESLL
TKTEDIPEGMILDYILNSGNKLDYDLSKDENEGIVDIKGFLDESEIFVFPETTTLPVPLL
QTEEPSTVEPSTQTETLGMYDSSFVMPAAEAPVSPPQTDLSVEDSLHVSTGTVSMEQPEE
SSVGQNIIPEVAEHQNKDRAVVEELFTVKQPDVMEAATIEHLDTISLETILTADPAVVKP
DASTREQQALDSSLADQNTRGSAVKEPAGVWPTDRALETSLDQTVQPAMPVVTQGPAAVP
SVTDHTAVLEGFAGQDGTDHGTHISISSSTVVDYQTVSVTTSTAELQSHPPPVGSTPSSS
VATPTKLGDGTTRVLDVSVDLGHASTVQFAPEQTEEGRRMTESHMELTTRVQSTEMASVA
WATHETHYSSTVPSRALVVFFSLRVTNMMFSEDLFNKNSPEYKALEQRFLELLVPYLQSN
LTGFQNLEILNFRNGSIVVNSRMKFAKPVPRNVTNAVYMILEDFCNTAYHTMNLAIDKYS
LDVESGEQADPCKFQACNEFSECLVNRWSGEAECVCNPGYLSIDGLPCSSICDLQPNFCL
NDGKCDISPGQGAICRCRVGENWWYRGEHCEEYVSEPLVVGIAIASVAGFLLVASAVIFF
LARTLRDQYTKSDTGDSQGQGDSLSSMENAVKYNPMYESDTTGYSHYYRRYPQLTSYSST
SAETSTDYSSEEIRHIYENSELTKEEIQDRIRIIELYAKDRQFAEFVRQHQM
Download sequence
Identical sequences H0ZTT3
ENSTGUP00000014030 59729.ENSTGUP00000014030 ENSTGUP00000014030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]