SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014044 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014044
Domain Number 1 Region: 260-420
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.96e-50
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000349
Further Details:      
 
Domain Number 2 Region: 47-156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-29
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 3 Region: 159-257
Classification Level Classification E-value
Superfamily LCCL domain 1.83e-24
Family LCCL domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014044   Gene: ENSTGUG00000013637   Transcript: ENSTGUT00000014203
Sequence length 718
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:118485261:118520420:-1 gene:ENSTGUG00000013637 transcript:ENSTGUT00000014203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSPGRLRPAGTRRAALLLRPSLLLLLLLLRGSEAHKGDGCGHTVLGPESGTLASINYPR
TSPNSTVCEWEIRVKPGQRLQLKFGDFDIDDSDSCHSSYLRVHNGIGPNRTEIGKYCGFG
FQMDGLITSKSNEVTVQFMSGIHTSGRGFLAAYSTTDKSDLITCLDNASHFSEPEFNKYC
PAGCVIPFADISGTIPHGYRDSSSLCMAGVHAGVVSNTLGGQINVVISKGIPYYEGSLAN
NVTSKVGPLSVSLFTFKTSGCYGTLGMESGVIPDSHITSSSTLEWPNQTGQVNIWKPENA
RLKRIGPPWAAFINDEHQWLQVDLNKEKKITGIITTGSTLAEHYYYVSAYRILYSDDAQK
WTVYREPGMGKDKIFQGNTELYQEVRNNFIPPIIARFFRINPVKWHQKIAMKVELLGCQF
SIGRAPKITFPAPPRNKNDEKNADFVDEFIHSVKTSLQTDKTTFTPEIKNTTVTPSVTKD
VALAAVLVPVLVMVFTTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFFPTK
SAEHEETPVRYSSSEISHLRAREIPTMLQTESAEYAQPLVGGIVGTLHQRSTFKPEEGKE
ASYADLDPYNSPIQEVYHAYAEPLPVTGPEYATPIIMDMSSHPSTPLGAPSISTFKAAGN
QAPPLVGTCNKLLSRTDSASSAQALYDIPKGQPGPGSADQLVYQVPQSVAHPTVSKDE
Download sequence
Identical sequences H0ZTU7
59729.ENSTGUP00000014044 ENSTGUP00000014044 ENSTGUP00000014044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]